Align UDP-glucose 4-epimerase; EC 5.1.3.2 (characterized, see rationale)
to candidate WP_035135055.1 Q763_RS13115 UDP-glucose 4-epimerase GalE
Query= uniprot:L0FXG3 (337 letters) >NCBI__GCF_000769915.1:WP_035135055.1 Length = 338 Score = 358 bits (918), Expect = e-103 Identities = 174/336 (51%), Positives = 245/336 (72%), Gaps = 3/336 (0%) Query: 3 QILITGGAGYIGSHTAVALVNAGYEPIIVDNFSNSNKEVLNGLEKILGAPVKYHEGDCND 62 +IL+TGG G+IGSHT V L N G++ +++D+ SNS+ +VLNG+E I G ++ + D + Sbjct: 2 KILVTGGLGFIGSHTVVELQNEGFDVVVIDDLSNSSLDVLNGIESITGKKPEFEKIDLRE 61 Query: 63 RKFMQAVFEEN-DLQGVIHFAASKAVGESTKIPLTYYSNNINSLIILLETMKQFGVKDIV 121 ++ ++ F + D+ G+IHFAASKAVGES + PL YY NNI SL+ LL+ +++ + + Sbjct: 62 KQAVKDFFVKYPDVTGIIHFAASKAVGESVENPLLYYENNIGSLVYLLQELQKKQEFNFI 121 Query: 122 FSSSCTVYGQPDKLPVKETTPRKDAESPYGNTKKICEDILTDHVKSGAPARVVALRYFNP 181 FSSSCTVYGQ +K+P+ E P + A SPYGNTK+I E+I+ D K V LRYFNP Sbjct: 122 FSSSCTVYGQAEKMPITEGAPIQGALSPYGNTKQIGEEIIKDVAKVSG-INSVLLRYFNP 180 Query: 182 IGAHPSSLIGELPLGVPANLIPFVTQTGAGIREKITVFGDDYNTPDGTCIRDYIHVMDLA 241 +GAHPS IGELPLGVP NL+PF+TQT GIRE+++VFG+DY T DGTC+RDYIHV+DLA Sbjct: 181 VGAHPSVNIGELPLGVPLNLVPFITQTAIGIREQLSVFGNDYPTTDGTCVRDYIHVVDLA 240 Query: 242 DAHVKSIQYLADQPE-NFIDLFNVGTGNGNTVMEVIKAFEKVSEKPLNYEIGPRRSGDIE 300 AHV ++Q L D+ +++FN+GTG GN+V+EVI AFE+VS + LNY+I RR+GD+ Sbjct: 241 KAHVLALQRLIDKKNAEKVEVFNLGTGKGNSVLEVINAFERVSGQKLNYKIVDRRAGDVA 300 Query: 301 KVWANTDKVSKVLGWTPQFGLEEALRDAWNWQLSLK 336 + +A+T K + VLGW + L++AL AW W+ ++ Sbjct: 301 EAYADTAKANNVLGWKAELSLDDALASAWKWEQKVR 336 Lambda K H 0.316 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 374 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 338 Length adjustment: 28 Effective length of query: 309 Effective length of database: 310 Effective search space: 95790 Effective search space used: 95790 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate WP_035135055.1 Q763_RS13115 (UDP-glucose 4-epimerase GalE)
to HMM TIGR01179 (galE: UDP-glucose 4-epimerase GalE (EC 5.1.3.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01179.hmm # target sequence database: /tmp/gapView.984993.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01179 [M=332] Accession: TIGR01179 Description: galE: UDP-glucose 4-epimerase GalE Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.5e-127 408.7 0.0 8.4e-127 408.5 0.0 1.0 1 NCBI__GCF_000769915.1:WP_035135055.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000769915.1:WP_035135055.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 408.5 0.0 8.4e-127 8.4e-127 1 329 [. 2 336 .. 2 338 .] 0.97 Alignments for each domain: == domain 1 score: 408.5 bits; conditional E-value: 8.4e-127 TIGR01179 1 kiLvtGgaGyiGshvvrqllekgkevvvlDnlskgskealkalekit..evklvegdladkekleavleee.k 70 kiLvtGg G+iGsh+v++l+++g++vvv+D+ls++s ++l+ +e it + ++ + dl++k+++++++ + + NCBI__GCF_000769915.1:WP_035135055.1 2 KILVTGGLGFIGSHTVVELQNEGFDVVVIDDLSNSSLDVLNGIESITgkKPEFEKIDLREKQAVKDFFVKYpD 74 79********************************************99999****************987637 PP TIGR01179 71 idaviHfaaliavgEsvkePlkYYennvvntleLleamqkagvkkliFsssaavYgesekvpisEespln.pi 142 + +iHfaa++avgEsv++Pl YYenn+ + + Ll+++qk + +++iFsss++vYg+ ek+pi+E +p++ + NCBI__GCF_000769915.1:WP_035135055.1 75 VTGIIHFAASKAVGESVENPLLYYENNIGSLVYLLQELQKKQEFNFIFSSSCTVYGQAEKMPITEGAPIQgAL 147 99******************************************************************9989* PP TIGR01179 143 npYGrsklmvErilkdlkkadkelkvviLRYFnvaGAdeegeiGeasknat.hliklvaevavgkrekleifG 214 +pYG++k + E+i+kd++k+ ++++ v+LRYFn++GA+++ +iGe + + + +l++ ++++a+g re+l++fG NCBI__GCF_000769915.1:WP_035135055.1 148 SPYGNTKQIGEEIIKDVAKV-SGINSVLLRYFNPVGAHPSVNIGELPLGVPlNLVPFITQTAIGIREQLSVFG 219 ********************.**************************************************** PP TIGR01179 215 tdyptkDGtcvRDyiHveDlaeaHlaalealeeg...gesevynlGagqgfsvkevieavkkvsgkdikvela 284 +dypt+DGtcvRDyiHv Dla+aH+ al+ l ++ +++ev+nlG+g+g+sv+evi+a+++vsg+++++++ NCBI__GCF_000769915.1:WP_035135055.1 220 NDYPTTDGTCVRDYIHVVDLAKAHVLALQRLIDKknaEKVEVFNLGTGKGNSVLEVINAFERVSGQKLNYKIV 292 *****************************997653336789******************************** PP TIGR01179 285 drRaGDpaslvadaskikrelgwkpkyddLeeiiksawdWekklk 329 drRaGD+a+ +ad++k++++lgwk+++ L++ ++saw+We+k + NCBI__GCF_000769915.1:WP_035135055.1 293 DRRAGDVAEAYADTAKANNVLGWKAELS-LDDALASAWKWEQKVR 336 ****************************.************9875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (332 nodes) Target sequences: 1 (338 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 17.21 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory