Align 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43) (characterized)
to candidate WP_035130892.1 Q763_RS02540 3-phosphoglycerate dehydrogenase
Query= reanno::BFirm:BPHYT_RS11290 (321 letters) >NCBI__GCF_000769915.1:WP_035130892.1 Length = 320 Score = 134 bits (337), Expect = 3e-36 Identities = 93/276 (33%), Positives = 147/276 (53%), Gaps = 24/276 (8%) Query: 46 IGSSVKITPAMLEGATRLKALSTISVGFDQFDVADLTRRGIVLANTPDVLTESTADTVFS 105 + S+ ++ +++ LK + VG D DV +GI + NTP ++S A+ VF+ Sbjct: 48 VRSATQVRKDIIDNCPSLKIIGRGGVGMDNIDVEYAREKGIHVINTPAASSDSVAELVFA 107 Query: 106 LILASAR------RVVELAEWVKAGHWQHSIGPALFGVDVQGKTLGIVGLGRIGGAVARR 159 + + R R++ L + S G +++GKTLGI+G G+IG +VAR Sbjct: 108 HLFSGVRFLHDSNRLMPLEGDSNFNSLKKSYAA---GTELKGKTLGIIGFGKIGKSVAR- 163 Query: 160 AALGFNMKVLYTNRSANPQAE---EAYGARRVE-------LAELLATADFVCLQVPLTPE 209 ALG MKV+ +++ AE + Y + + + ++ ADF+ L VP + Sbjct: 164 IALGLGMKVIASDKFIG-NAEIRVDFYNGQFINVEISTEPIEDIFKHADFITLHVPA--Q 220 Query: 210 TKHLIGAAELKSMKKSAILINASRGATVDEKALIEALQNGTIHGAGLDVFETEPLPSDSP 269 +LIG AEL+SMK +INASRG +DE AL++AL +G + AGLDVFE EP P+ Sbjct: 221 DGYLIGKAELESMKDGVGIINASRGGIIDEVALVDALDSGKVAFAGLDVFEEEPKPAIQV 280 Query: 270 LLKLANVVALPHIGSATHETRHAMARNAAENLVAAL 305 L+ + PHIG+AT E + + AE +++ L Sbjct: 281 LMN-PKISLTPHIGAATLEAQDRIGTELAEQIISIL 315 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 217 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 320 Length adjustment: 28 Effective length of query: 293 Effective length of database: 292 Effective search space: 85556 Effective search space used: 85556 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory