Align ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, ATPase component (characterized)
to candidate WP_035130886.1 Q763_RS02520 ABC transporter ATP-binding protein
Query= reanno::pseudo3_N2E3:AO353_16275 (244 letters) >NCBI__GCF_000769915.1:WP_035130886.1 Length = 222 Score = 140 bits (353), Expect = 2e-38 Identities = 85/221 (38%), Positives = 129/221 (58%), Gaps = 8/221 (3%) Query: 1 MISIKNVNKWYGDFQVLTDCSTEVKKGEVIVVCGPSGSGKSTLIKCVNALEP--FQKG-D 57 MI KN++K+Y VL +KKGEV+ + G SG+GK+TL++ + L+ +KG Sbjct: 1 MIQAKNIHKYYDSLHVLKGVDLHIKKGEVVSIVGASGAGKTTLLQILGTLDKPKSEKGTS 60 Query: 58 VVVDGTSIADPKTD-LPKLRS-RVGMVFQHFELFPHLTITENLTIAQIKVLGRSKEEATK 115 +++DG + + K L K R+ ++G +FQ +LFP T EN+ I + G+ K E Sbjct: 61 LLIDGEDVLNMKDKALSKFRNLKLGFIFQFHQLFPEFTALENVCIPAF-IAGKQKAETEA 119 Query: 116 KGLQLLERVGLSAHAHKHPGQLSGGQQQRVAIARALAMDPIVMLFDEPTSALDPEMVNEV 175 + +LLE +GLS + PG+LSGG+QQRVA+ARAL P V+ DEP+ LD + Sbjct: 120 EAKKLLEYLGLSHRINHKPGELSGGEQQRVAVARALINKPAVIFADEPSGNLDTHSAENL 179 Query: 176 LDVMVQLANE-GMTMMCVTHEMGFARKVADRVIFMDQGKII 215 ++ +L +E G T + VTH A +ADR + M G+II Sbjct: 180 HNLFFKLRDEMGQTFVIVTHNEELA-NMADRKLVMSDGQII 219 Lambda K H 0.321 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 126 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 244 Length of database: 222 Length adjustment: 23 Effective length of query: 221 Effective length of database: 199 Effective search space: 43979 Effective search space used: 43979 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory