Align Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex; EC 2.3.1.168; Branched-chain alpha-keto acid dehydrogenase complex component E2; BCKAD-E2; BCKADE2; Dihydrolipoamide acetyltransferase component of branched-chain alpha-keto acid dehydrogenase complex; Dihydrolipoamide branched chain transacylase; Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase (uncharacterized)
to candidate WP_035132427.1 Q763_RS06555 2-oxo acid dehydrogenase subunit E2
Query= curated2:P37942 (424 letters) >NCBI__GCF_000769915.1:WP_035132427.1 Length = 440 Score = 292 bits (748), Expect = 1e-83 Identities = 178/442 (40%), Positives = 259/442 (58%), Gaps = 21/442 (4%) Query: 1 MAIEQMTMPQLGESVTEGTISKWLVAPGDKVNKYDPIAEVMTDKVNAEVPSSFTGTITEL 60 MA ++T+P++GESV E TI+ WL GD++ + + E+ TDKV++EVPS +G +TE+ Sbjct: 1 MAKFELTLPKMGESVAEATITNWLKNVGDRIEADEAVLEIATDKVDSEVPSEVSGVLTEI 60 Query: 61 VGEEGQTLQVGEMICKIETEGANPAEQKQEQPAASEAAENPVAKSAGAADQ--------- 111 + + +QVG+ I IETEG E + AA AAE VAK+ A + Sbjct: 61 LFQVDDVVQVGQTIAYIETEGGAATEAPKATEAAPAAAE-AVAKTVEVAQETAATAQVDF 119 Query: 112 -PNKKRYSPAVLRLAGEHGI---DLDQVTGTGAGGRITRKDIQRLIETGGVQEQNPEELK 167 + K +SP V +A E GI +L+ + GTG GR+T+ DI I+ G Q + + Sbjct: 120 SESDKFFSPLVKNIAKEEGISLAELEAINGTGKDGRVTKNDILDYIKNRGSQPA-AQPAQ 178 Query: 168 TAAPAPKSASKPEPKEET-SYPASAAGDKEI-PVTGVRKAIASNMKRSKTEIPHAWTMME 225 TAAP K+A +P + + P S G EI + +RK I+ M +S H + +E Sbjct: 179 TAAPVAKAAPAAQPAQAAKAAPVSVNGQDEIVEMDRMRKLISGYMVQSVQTSAHVQSFIE 238 Query: 226 VDVTNMVAYRNSIKDSFKKTEGFNLTFFAFFVKAVAQALKEFPQMNSMWAGDKIIQKKDI 285 VDVTN+V +R+ +K +F+K EG LTF F++AVA+ALK+FP MN G+ II+KK+I Sbjct: 239 VDVTNIVKWRDKVKGAFEKREGEKLTFTPIFMEAVAKALKDFPLMNISVDGEYIIKKKNI 298 Query: 286 NISIAVATED-SLFVPVIKNADEKTIKGIAKDITGLAKKVRDGKLTADDMQGGTFTVNNT 344 N+ +A A + +L VPVIKNAD+ + G+AK + L + + GKL DD QGGT+TV N Sbjct: 299 NLGMAAALPNGNLIVPVIKNADQLNLVGMAKAVNDLGNRAKAGKLKPDDTQGGTYTVTNV 358 Query: 345 GSFGSVQSMGIINYPQAAILQVESIVKRPVVM---DNGMIAVRDMVNLCLSLDHRVLDGL 401 G+FGSV IIN PQ IL + +I K P V+ + I +R + L S DHRV+DG Sbjct: 359 GTFGSVFGTPIINQPQVGILALGAIRKVPAVIETPEGDFIGIRQKMFLSHSYDHRVVDGA 418 Query: 402 VCGRFLGRVKQILESIDEKTSV 423 + G F+ RV + LE+ D + Sbjct: 419 LGGSFVKRVAEYLEAFDPNRDI 440 Lambda K H 0.312 0.129 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 443 Number of extensions: 21 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 424 Length of database: 440 Length adjustment: 32 Effective length of query: 392 Effective length of database: 408 Effective search space: 159936 Effective search space used: 159936 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory