Align Branched-chain-amino-acid aminotransferase 2; BCAT 2; Vegetative protein 85; VEG85; EC 2.6.1.42 (characterized)
to candidate WP_035131886.1 Q763_RS05105 branched-chain amino acid aminotransferase
Query= SwissProt::P39576 (363 letters) >NCBI__GCF_000769915.1:WP_035131886.1 Length = 352 Score = 286 bits (731), Expect = 8e-82 Identities = 147/357 (41%), Positives = 217/357 (60%), Gaps = 6/357 (1%) Query: 1 MTKQTIRVELT-STKKPKPDPNQLSFGRVFTDHMFVMDYAADKGWYDPRIIPYQPLSMDP 59 M + I V L +K D L+FG VFTDHM + DY + W P I PY+P +DP Sbjct: 1 MNENDITVNLAPGSKIDSVDFENLTFGNVFTDHMLICDYK-NGVWEKPVIKPYEPFLIDP 59 Query: 60 AAMVYHYGQTVFEGLKAYVSEDDHVLLFRPEKNMERLNQSNDRLCIPQIDEEQVLEGLKQ 119 +A V+HYGQ +FEG+KAY E+D V LFRP++N ER N+S RL +P++ E + GLK+ Sbjct: 60 SAKVFHYGQAIFEGMKAYKDENDDVWLFRPDQNYERFNKSATRLAMPEVPENVFMGGLKK 119 Query: 120 LVAIDKDWIPNAEGTSLYIRPFIIATEPFLGVAASHTYKLLIILSPVGSYYKEGIKPVKI 179 LV I+K W+ +G SLYIRPF+IAT P + A + Y+ +IILSP SYY VK+ Sbjct: 120 LVEIEKAWVKKGKGNSLYIRPFMIATGPGVLAAPALFYRFMIILSPAKSYYS---GEVKV 176 Query: 180 AVESEFVRAVKGGTGNAKTAGNYASSLKAQQVAEEKGFSQVLWLDGIEKKYIEEVGSMNI 239 + F RA GG G AK AGNY++ ++A E+G+ Q++W D +EE G+MN+ Sbjct: 177 LIAEHFSRAANGGIGAAKAAGNYSAQFYPTKLANEQGYQQIIWTDDATHTKLEEAGTMNV 236 Query: 240 FFKINGEIVTPMLNGSILEGITRNSVIALLKHWGLQVSERKIAIDEVIQAHKDGILEEAF 299 FF+IN + T + IL+G+TR S+I + K G+ V R + + E+++A ++G L+E F Sbjct: 237 FFRINDTLYTAPTSERILDGVTRKSLIDVAKREGINVEVRPVLVSELVEATENGTLQEVF 296 Query: 300 GTGTAAVISPVGELIWQDETLSINNGETGEIAKKLYDTITGIQKGAVADEFGWTTEV 356 G GTAAV++P+ ++++ + E +A L + + IQ D FGWT ++ Sbjct: 297 GAGTAAVVNPIVGFSYKEKYYELPKQE-NSVALFLKEKLNNIQYKLAEDTFGWTVKI 352 Lambda K H 0.316 0.135 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 376 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 352 Length adjustment: 29 Effective length of query: 334 Effective length of database: 323 Effective search space: 107882 Effective search space used: 107882 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate WP_035131886.1 Q763_RS05105 (branched-chain amino acid aminotransferase)
to HMM TIGR01123 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01123.hmm # target sequence database: /tmp/gapView.1713412.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01123 [M=313] Accession: TIGR01123 Description: ilvE_II: branched-chain amino acid aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.5e-100 320.3 0.0 6.2e-100 320.2 0.0 1.0 1 NCBI__GCF_000769915.1:WP_035131886.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000769915.1:WP_035131886.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 320.2 0.0 6.2e-100 6.2e-100 1 313 [] 44 352 .] 44 352 .] 0.98 Alignments for each domain: == domain 1 score: 320.2 bits; conditional E-value: 6.2e-100 TIGR01123 1 WdeaelaseaeleldegsavlhYgqevfeGlkayRtadGkillfRpdanakRlrrsaerlllPeleeelflea 73 W+++ +++++++ +d++++v+hYgq++feG+kay+ ++ ++lfRpd+n +R+++sa rl++Pe++e++f+ NCBI__GCF_000769915.1:WP_035131886.1 44 WEKPVIKPYEPFLIDPSAKVFHYGQAIFEGMKAYKDENDDVWLFRPDQNYERFNKSATRLAMPEVPENVFMGG 116 999********************************************************************** PP TIGR01123 74 lkqlvkadkdwvpkakseasLYlRPfliatednlGvkaakeylflvlasPvGaYfkgglapvsifveteyvRa 146 lk+lv+++k+wv k k ++sLY+RPf+iat++ + ++a y+f++++sP+ +Y+ g++++ ++ +++ Ra NCBI__GCF_000769915.1:WP_035131886.1 117 LKKLVEIEKAWVKKGK-GNSLYIRPFMIATGPGVLAAPALFYRFMIILSPAKSYYSGEVKV---LIAEHFSRA 185 ************9777.9***************************************9887...********* PP TIGR01123 147 apkGtGavkvgGnYaasllaqkkaaeqglddvvyldpvekkkieevGaaniflitkdgelvttplsesiLegv 219 a++G+Ga+k +GnY+a + + k a+eqg++++++ d ++++k+ee+G++n+f+ ++d +l t p se iL+gv NCBI__GCF_000769915.1:WP_035131886.1 186 ANGGIGAAKAAGNYSAQFYPTKLANEQGYQQIIWTDDATHTKLEEAGTMNVFFRIND-TLYTAPTSERILDGV 257 ********************************************************9.*************** PP TIGR01123 220 tresllelakdlgleveereiaidelkaaveaGei..vfacGtaavitPvgelkiegkevevkseevGevtkk 290 tr+sl+ +ak g++ve r + + el +a+e+G + vf++Gtaav+ P+ +++ ++k +e+ ++ v+ NCBI__GCF_000769915.1:WP_035131886.1 258 TRKSLIDVAKREGINVEVRPVLVSELVEATENGTLqeVFGAGTAAVVNPIVGFSYKEKYYELPKQ-ENSVALF 329 *********************************9899************************9988.6799*** PP TIGR01123 291 lrdeltdiqyGkledkegWivev 313 l+++l +iqy +ed++gW+v++ NCBI__GCF_000769915.1:WP_035131886.1 330 LKEKLNNIQYKLAEDTFGWTVKI 352 ********************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (313 nodes) Target sequences: 1 (352 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 22.42 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory