Align ABC-type maltose transporter (subunit 3/3) (EC 7.5.2.1) (characterized)
to candidate WP_035132405.1 Q763_RS06510 ABC transporter ATP-binding protein
Query= BRENDA::P68187 (371 letters) >NCBI__GCF_000769915.1:WP_035132405.1 Length = 233 Score = 135 bits (340), Expect = 1e-36 Identities = 82/217 (37%), Positives = 128/217 (58%), Gaps = 12/217 (5%) Query: 4 VQLQNVTKAW---GEVV-VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGD 59 + ++++T+ + EVV V K I+L I++GE+V +GPSG GKSTL+ ++ L+T T G Sbjct: 6 IDIKSITRNFPLGNEVVKVLKGIDLTINKGEYVALMGPSGSGKSTLMNLLGCLDTPTGGT 65 Query: 60 LFIGEK---RMNDTPPAE---RGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQR 113 + K +M+D AE + +G VFQ++ L P + +N++ + AG KK N+R Sbjct: 66 YILNGKDVSKMSDNELAEIRNKEIGFVFQTFNLLPRTTALDNVALPMVYAGYKKPERNER 125 Query: 114 VNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMR 173 +QV + L +D KP LSGGQRQRVA+ R LV PS+ L DEP NLD+ V++ Sbjct: 126 ASQVLTQVGLEDRMDHKPNQLSGGQRQRVAVARALVNHPSIILADEPTGNLDSKTSVEIM 185 Query: 174 IEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAG 210 + +H G T+I VTH++ + A +++ L G Sbjct: 186 KLFNEIHAN-GNTVILVTHEE-DIAAYAHRVIRLRDG 220 Lambda K H 0.320 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 183 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 233 Length adjustment: 26 Effective length of query: 345 Effective length of database: 207 Effective search space: 71415 Effective search space used: 71415 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory