Align ABC transporter for D-Mannitol, D-Mannose, and D-Mannose, ATPase component (characterized)
to candidate WP_035132405.1 Q763_RS06510 ABC transporter ATP-binding protein
Query= reanno::pseudo13_GW456_L13:PfGW456L13_3039 (367 letters) >NCBI__GCF_000769915.1:WP_035132405.1 Length = 233 Score = 145 bits (365), Expect = 1e-39 Identities = 83/216 (38%), Positives = 128/216 (59%), Gaps = 14/216 (6%) Query: 7 KNLQKGFEGFSIIKGIDLEVNDKEFVVFVGPSGCGKSTLLRLIAGLEEVSGGTIELDGRD 66 +N G E ++KGIDL +N E+V +GPSG GKSTL+ L+ L+ +GGT L+G+D Sbjct: 13 RNFPLGNEVVKVLKGIDLTINKGEYVALMGPSGSGKSTLMNLLGCLDTPTGGTYILNGKD 72 Query: 67 ITEVSPAK------RDLAMVFQTYALYPHMSVRKNMSFALDLAGVAKAEVEKKVSEAARI 120 ++++S + +++ VFQT+ L P + N++ + AG K E ++ S+ Sbjct: 73 VSKMSDNELAEIRNKEIGFVFQTFNLLPRTTALDNVALPMVYAGYKKPERNERASQVLTQ 132 Query: 121 LELGPMLERKPKQLSGGQRQRVAIGRAIVRNPKIFLFDEPLSNLDAALRVQMRLELLRLH 180 + L ++ KP QLSGGQRQRVA+ RA+V +P I L DEP NLD+ V E+++L Sbjct: 133 VGLEDRMDHKPNQLSGGQRQRVAVARALVNHPSIILADEPTGNLDSKTSV----EIMKLF 188 Query: 181 KELQA---TMIYVTHDQVEAMTMADKVVVLNGGKIE 213 E+ A T+I VTH++ + A +V+ L G IE Sbjct: 189 NEIHANGNTVILVTHEE-DIAAYAHRVIRLRDGVIE 223 Lambda K H 0.320 0.137 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 193 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 233 Length adjustment: 26 Effective length of query: 341 Effective length of database: 207 Effective search space: 70587 Effective search space used: 70587 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory