Align ABC transporter for D-Mannitol, D-Mannose, and D-Mannose, ATPase component (characterized)
to candidate WP_035136158.1 Q763_RS16555 ABC transporter ATP-binding protein
Query= reanno::pseudo13_GW456_L13:PfGW456L13_3039 (367 letters) >NCBI__GCF_000769915.1:WP_035136158.1 Length = 234 Score = 132 bits (333), Expect = 7e-36 Identities = 83/219 (37%), Positives = 121/219 (55%), Gaps = 12/219 (5%) Query: 4 LKIKNLQKGFEGFSI----IKGIDLEVNDKEFVVFVGPSGCGKSTLLRLIAGLEEVSGGT 59 +KI+NL K F + + I +EV EFV +G SGCGKSTLL ++ L+ SGG+ Sbjct: 2 IKIENLSKVFRTEEVETKALNDISIEVKKGEFVTIMGASGCGKSTLLNIVGLLDSASGGS 61 Query: 60 IELDGRDITEVSPA------KRDLAMVFQTYALYPHMSVRKNMSFALDLAGVAKAEVEKK 113 +L R+I +S + K ++ VFQ + L +SV N+ L V E +K+ Sbjct: 62 YKLLDREINGLSESEKAKVRKENIGFVFQNFNLIDELSVYDNIELPLIYNNVPSGERKKR 121 Query: 114 VSEAARILELGPMLERKPKQLSGGQRQRVAIGRAIVRNPKIFLFDEPLSNLDAALRVQMR 173 V E A L + L+ P+QLSGGQ+QR A+ RA+V NPKI L DEP NLD+ ++ Sbjct: 122 VEEIAERLGISHRLKHYPQQLSGGQQQRAAVARALVNNPKIILADEPTGNLDSKNGNEVM 181 Query: 174 LELLRLHKELQATMIYVTHDQVEAMTMADKVVVLNGGKI 212 L LH AT++ VTH + +A + + K + + G I Sbjct: 182 ELLTDLHAN-GATILMVTHSEYDA-SFSQKTIYMKDGMI 218 Lambda K H 0.320 0.137 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 165 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 234 Length adjustment: 26 Effective length of query: 341 Effective length of database: 208 Effective search space: 70928 Effective search space used: 70928 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory