Align D-mannitol and D-mannose transporter (MFS superfamily) (characterized)
to candidate WP_035132977.1 Q763_RS07965 MFS transporter
Query= reanno::SB2B:6936374 (413 letters) >NCBI__GCF_000769915.1:WP_035132977.1 Length = 480 Score = 211 bits (537), Expect = 4e-59 Identities = 142/448 (31%), Positives = 218/448 (48%), Gaps = 74/448 (16%) Query: 25 FGAMTSLFFIWGFITALNDILIPHLKGIFDLSYTQAMLVQFCFFGAYFLVSPL-AGV--- 80 F + S+FF WGF+ A NDILIP K F+LS +Q+ LV F+ AY + S + G+ Sbjct: 14 FIPLVSVFFFWGFVAASNDILIPVFKEAFELSQSQSQLVAVAFYVAYTIGSLIYIGISFL 73 Query: 81 ----LIARIGYLRGIIFGLSTMATGCLLFYPASSLEQYALFLLALFVLASGITILQVSAN 136 ++ ++GY + GL A G LLFYPA++ + L L LF++ G ++ Q AN Sbjct: 74 MKQDIVNKLGYKNSLAVGLVISALGTLLFYPAANTGSFPLMLSGLFIVGLGFSLQQTVAN 133 Query: 137 PFVARLGPERTAASRLNLAQALNSLGHTLGPLFGSLLIFGAAAG-----THEAVQLPYLL 191 P LG T + RL LA +N+ G T+GPL S IFG+ + + E+V+ PYL+ Sbjct: 134 PLAIALGSPSTGSQRLTLAGGINNFGTTIGPLIVSFAIFGSVSSPSTEVSVESVKAPYLI 193 Query: 192 LAAVIGIIAVGFIFLGGKVKH----ADMGVDHRHKG-SLLSHKRLLLGALAIFLYVGAEV 246 L + ++A + + H D+ + G S L + +L+LG +AIFLYVG EV Sbjct: 194 LGGIF-LLAAILLKVSSLPNHPATEEDIVEEISSAGKSALKYPQLVLGMVAIFLYVGVEV 252 Query: 247 SIGSFLVNYFAEPSIGGLDEKSAAELVSWYWGGAMIGRFAGAA----------------- 289 + S L Y + G K A VS YW MIGR+ GA Sbjct: 253 ATASNLPAYLEKGM--GFSTKDVAPYVSLYWASLMIGRWTGAVEVFTQNKKMLKVLKFVA 310 Query: 290 ------------------------------------LTRRFNPAMVLAANAVFANLLLML 313 + + NPA +L + + ++ Sbjct: 311 PYLAFGVFLGVNAIAEHDLQPFYVYAVIILVLIGADIASKGNPAKMLLLFSALGIVASII 370 Query: 314 TIVSSGELALVAVLAVGFFNSIMFPTIFTLAIEGLGELTSRGSGLLCQAIVGGALLPVIQ 373 + ++G +++ A ++G F S ++P IF LAI GLG+ T++GS L I+GG ++ IQ Sbjct: 371 GMSTTGMVSVYAFTSIGLFCSTLWPCIFALAINGLGKQTNQGSNYLIMMIMGGGIVSWIQ 430 Query: 374 GVVADNVGVQLSFIVPTFCYFYICWYAF 401 G+VAD + S+IV C+ Y+ +YA+ Sbjct: 431 GLVADATSIHTSYIVGVICFAYLVFYAW 458 Lambda K H 0.329 0.142 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 476 Number of extensions: 25 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 413 Length of database: 480 Length adjustment: 32 Effective length of query: 381 Effective length of database: 448 Effective search space: 170688 Effective search space used: 170688 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory