Align aldehyde dehydrogenase (NAD+) (EC 1.2.1.3) (characterized)
to candidate WP_052123206.1 Q763_RS03145 NAD-dependent succinate-semialdehyde dehydrogenase
Query= BRENDA::P05091 (517 letters) >NCBI__GCF_000769915.1:WP_052123206.1 Length = 451 Score = 197 bits (501), Expect = 7e-55 Identities = 141/457 (30%), Positives = 215/457 (47%), Gaps = 13/457 (2%) Query: 56 TVNPSTGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERD 115 T NP + + V++ ++ ++ +F+ W + R + + L ++ + Sbjct: 4 TTNPYDLSTLSEYQYYTDIQVNQMLEISQKSFR---KWGKTPLKKRVKFIKNLIFVLTKK 60 Query: 116 RTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKY-HGKTIPIDGDFFSYTRHE 174 + LA + + GKP + L C +Y A+K+ + I D S+ HE Sbjct: 61 QHLLAEKCSQEMGKPLKQAIAEVKKCSLLC-EFYLEHAEKFLQDEKISSDAGE-SFVTHE 118 Query: 175 PVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGV 234 P+GV ++PWNFP PA+ GN VV+K A A + L KEA FP + Sbjct: 119 PLGVILGVMPWNFPYWQVFRFAIPAIIAGNTVVVKHASNVAECAQLLEELFKEAEFPEMI 178 Query: 235 VNIVPGFGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSSNL-KRVTLELGGKSPNI 293 + G I + + V+ TGS + G VA+ ++NL K+ LELGG + I Sbjct: 179 YQNLQISGSQVKNVI-ENPIIKGVSLTGSEKAGAT--VASTAANLIKKSVLELGGSNAFI 235 Query: 294 IMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFD 353 ++ DAD+D AV A A N GQ C A R V +YDEF++R K GNP D Sbjct: 236 VLEDADLDKAVPVAVTARMQNTGQSCIAAKRFLVHSSLYDEFLKRFTTEVKKLKSGNPMD 295 Query: 354 SKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTIA 413 T+ GP + I +N GAK++ GG F +PT+ +V M + Sbjct: 296 EDTDIGPLARVDLAEDIEKQVNKSVDMGAKVIIGG---RRNNAFYEPTIVVNVTSDMPLF 352 Query: 414 KEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCY 473 EE+FGPV ++ F + EE V +N S +GL +FT+D++ + G V++N Sbjct: 353 NEEVFGPVAPVIAFDSFEEAVKLSNYSDFGLGVNIFTEDIEGIKEKISLFEEGAVFINAM 412 Query: 474 DVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTV 510 PFGG K SG GREL E G++ + VKTV + Sbjct: 413 VKSDPALPFGGVKKSGFGRELAENGIKEFVNVKTVYI 449 Lambda K H 0.319 0.136 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 461 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 517 Length of database: 451 Length adjustment: 34 Effective length of query: 483 Effective length of database: 417 Effective search space: 201411 Effective search space used: 201411 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory