Align NAD(P)+-dependent L-rhamnose 1-dehydrogenase (EC 1.1.1.378; EC 1.1.1.173) (characterized)
to candidate WP_035131108.1 Q763_RS03170 3-oxoacyl-[acyl-carrier-protein] reductase
Query= metacyc::MONOMER-16231 (254 letters) >NCBI__GCF_000769915.1:WP_035131108.1 Length = 248 Score = 186 bits (473), Expect = 3e-52 Identities = 108/249 (43%), Positives = 152/249 (61%), Gaps = 3/249 (1%) Query: 1 MKLLEGKTVLVTGASTGIGRAAAIGAAQHGADVAINYAHSDGPAQSCVAEIEALGQRAIA 60 MKLLEGKT ++TGAS GIGR A A+HGA+VA Y+ S A++ E+ ALG +A Sbjct: 1 MKLLEGKTAIITGASRGIGRGIAQVFAKHGANVAFTYSSSAEAAKTLEDELTALGIKAKG 60 Query: 61 VKGDVADPQTAQDFVAKAVETFGKVDVMVSNAGICPFHAFLDMPVDVVERTFKVNLHGAY 120 + + AD AQ V + VETFG VD++++NAGI + + + + ++ +VNL + Sbjct: 61 YQSNAADFNEAQKLVDEVVETFGTVDILINNAGITKDNLLMRISEEDFDKVIEVNLKSVF 120 Query: 121 FMVQAAAQQMVRQGHGGSIVAVSSISALVGGEYQTHYTPTKAGVHSLMQSTAIALGKHGI 180 M +A + M++Q H GSI+ +SS+ + G QT+Y +KAGV +S A+ LG I Sbjct: 121 NMTKAVQRTMLKQRH-GSIINMSSVVGVKGNAGQTNYAASKAGVIGFTKSVALELGSRNI 179 Query: 181 RCNSVLPGTILTEINKDDLADQEKREYMEARTPLGRLGAPEDLAGPIVFLASDMAAYVTG 240 RCN++ PG I TE+ + AD K PL R G PED+A V+LASD++AYVTG Sbjct: 180 RCNAIAPGFIETEMTEKLGADVIKG--WTENIPLKRGGTPEDVANACVYLASDLSAYVTG 237 Query: 241 AALLVDGGM 249 L VDGGM Sbjct: 238 QTLNVDGGM 246 Lambda K H 0.318 0.133 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 137 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 248 Length adjustment: 24 Effective length of query: 230 Effective length of database: 224 Effective search space: 51520 Effective search space used: 51520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory