Align ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized)
to candidate WP_035136158.1 Q763_RS16555 ABC transporter ATP-binding protein
Query= reanno::Smeli:SMc03065 (362 letters) >NCBI__GCF_000769915.1:WP_035136158.1 Length = 234 Score = 114 bits (284), Expect = 3e-30 Identities = 68/215 (31%), Positives = 110/215 (51%), Gaps = 9/215 (4%) Query: 5 LLKDIRKSYGAVDVIHGIDLDIKEGEFVVFVGPSGCGKSTLLRMIAGLEEITGGDMFIDG 64 L K R ++ I +++K+GEFV +G SGCGKSTLL ++ L+ +GG + Sbjct: 7 LSKVFRTEEVETKALNDISIEVKKGEFVTIMGASGCGKSTLLNIVGLLDSASGGSYKLLD 66 Query: 65 ERVNDVPPS------KRGIAMVFQSYALYPHMTVYDNMAFGMRIARESKEEIDRRVRGAA 118 +N + S K I VFQ++ L ++VYDN+ + E +RV A Sbjct: 67 REINGLSESEKAKVRKENIGFVFQNFNLIDELSVYDNIELPLIYNNVPSGERKKRVEEIA 126 Query: 119 DMLQLTPYLDRLPKALSGGQRQRVAIGRAICRNPKVFLFDEPLSNLDAALRVATRIEIAK 178 + L ++ L P+ LSGGQ+QR A+ RA+ NPK+ L DEP NLD+ + + Sbjct: 127 ERLGISHRLKHYPQQLSGGQQQRAAVARALVNNPKIILADEPTGNLDS--KNGNEVMELL 184 Query: 179 LSERMSDTTMIYVTHDQVEAMTLADRIVVLSAGHI 213 + T++ VTH + +A + + + + + G I Sbjct: 185 TDLHANGATILMVTHSEYDA-SFSQKTIYMKDGMI 218 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 200 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 234 Length adjustment: 26 Effective length of query: 336 Effective length of database: 208 Effective search space: 69888 Effective search space used: 69888 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory