Align AraV, component of Arabinose, fructose, xylose porter (characterized)
to candidate WP_035129644.1 Q763_RS00100 ATP-binding cassette domain-containing protein
Query= TCDB::Q97UF2 (371 letters) >NCBI__GCF_000769915.1:WP_035129644.1 Length = 267 Score = 135 bits (340), Expect = 1e-36 Identities = 81/223 (36%), Positives = 119/223 (53%), Gaps = 1/223 (0%) Query: 11 KIFKKGKTEVKAVDNVSITIDSGMAFGVLGPSGHGKTTFLRLIAGLEEPTSGYIYFDNEA 70 K +K + K + +S T ++G ++G SG GKT L+ + G+ P G I FD Sbjct: 5 KDIEKSFGDTKVLKGISTTFETGKTNLIIGRSGSGKTVMLKTLLGIHTPEKGSISFDGRI 64 Query: 71 VSSPRRVMMSPEKRGIAMVFQNWALYPNMTVFDNIAFPLKLAKVPKDK-IENKVKEVSEE 129 S R + I MVFQ AL+ +M V DN+AFPLK+ + + I+++V EV E Sbjct: 65 YSELTRDEKRSLRTEIGMVFQGSALFDSMNVEDNVAFPLKMFTNKRGREIKDRVNEVLER 124 Query: 130 LGLSGVLNRYPKELSGGQMQRTAIARALVKDPKVLLLDEPFSNLDAQIRESARALVRKIQ 189 + L ++P E+SGG +R AIARA+V +PK L DEP S LD + L+++I Sbjct: 125 VNLVDANYKFPNEISGGMQKRVAIARAIVNNPKYLFCDEPNSGLDPETSILIDELIQEIT 184 Query: 190 RERKLTTLIVSHDPADIFAIANKAGVIVNGKFAQIGTPTEIYE 232 RE +TT+I +HD + I K + NG GT +I E Sbjct: 185 REYDMTTVINTHDMNSVLQIGEKIVFLKNGIKEWEGTNEQILE 227 Lambda K H 0.317 0.136 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 232 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 267 Length adjustment: 27 Effective length of query: 344 Effective length of database: 240 Effective search space: 82560 Effective search space used: 82560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory