Align ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_035132493.1 Q763_RS06750 ATP-binding cassette domain-containing protein
Query= TCDB::Q8DQH7 (236 letters) >NCBI__GCF_000769915.1:WP_035132493.1 Length = 299 Score = 112 bits (281), Expect = 6e-30 Identities = 73/228 (32%), Positives = 123/228 (53%), Gaps = 12/228 (5%) Query: 2 SVLKVENLSVHYGMIQAVRDVSFEVNEGEVVSLIGANGAGKTTILRTLSGLVRPSSGKIE 61 ++L + NL + + AV +VSFE+ +G V ++G NG+GK+T L + +V +SG Sbjct: 3 TILTINNLHKKFRHVHAVNNVSFEIKKGNVYGILGPNGSGKSTTLGIILNVVNKTSGSYS 62 Query: 62 FLGQEIQKMPAQKIVAGGLSQVPEGRHVFPGLTVMENLEMGAFLKKNREENQANLKKVFS 121 + +++ A K V + E + +P +T ENL++ +K A L+K+ Sbjct: 63 WFNGDLETHDALKKVGA----IIERPNFYPYMTAYENLKLVCGIKG------APLEKIDE 112 Query: 122 RFPR--LEERKNQDAATLSGGEQQMLAMGRALMSTPKLLLLDEPSMGLAPIFIQEIFDII 179 + L ERK+ T S G +Q LA+ AL++ P++L+LDEP+ GL P I++I DII Sbjct: 113 KLELVGLLERKDSKFKTYSLGMKQRLAIASALLNDPEILILDEPTNGLDPQGIRQIRDII 172 Query: 180 QDIQKQGTTVLLIEQNANKALAISDRGYVLETGKIVLSGTGKELASSE 227 + I GTT+LL ++ + VL G ++ +GT + S+E Sbjct: 173 RHIASLGTTILLASHLLDEVEKVCSHVVVLRKGVVLYTGTVNGMISNE 220 Lambda K H 0.315 0.134 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 137 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 299 Length adjustment: 25 Effective length of query: 211 Effective length of database: 274 Effective search space: 57814 Effective search space used: 57814 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory