Align Glyoxylate reductase; EC 1.1.1.26 (characterized)
to candidate WP_036834129.1 N784_RS08505 D-glycerate dehydrogenase
Query= SwissProt::Q9C4M5 (331 letters) >NCBI__GCF_000775615.1:WP_036834129.1 Length = 321 Score = 287 bits (735), Expect = 2e-82 Identities = 150/318 (47%), Positives = 209/318 (65%), Gaps = 6/318 (1%) Query: 2 KPKVFITRQIPENGIKMIEKFYEIELWKDPKAP-PRGVLLEKVREVDALVTLVTDKVDKE 60 KP +FITR +PE I ++I++W + P R +L+++ + DAL+T+++D++D++ Sbjct: 3 KPYIFITRTLPEEIIAPFRANWDIQMWDSEEKPVDRTILIQETAKADALITMLSDRIDEQ 62 Query: 61 LLENAPKLKIIAQYAVGYDNIDIEEATKRGIYVTNTPGVLTDATADLAFALLLAVARRIV 120 LLE +LK+IA AVG+DNID++ A K+GI VTNTP VLT+ TADL F LL+A ARR + Sbjct: 63 LLEQGAQLKVIANLAVGFDNIDVKAAQKKGIIVTNTPDVLTETTADLTFGLLMATARRFI 122 Query: 121 EADAFVRSGEWKKSEVGWHPLMFLGYGLKGKTLGIVGFGRIGQALAKRAKGFGMKIIYYS 180 EA +R+G W+ W PL+ G + KT+GIVG GRIG+A+A RA+GF M ++Y++ Sbjct: 123 EASDHIRNGNWEN----WAPLLLAGLDIHHKTIGIVGMGRIGRAVAHRAQGFHMNVLYHN 178 Query: 181 RTRKPEAEEEIGAEYVDFETLLKESDFISLHVPLTKETYHMIGEKELKLMKPNAILINTS 240 R+R EAE +GA YV FE LL++SDF+ P T+ET M K + MK +A+ IN S Sbjct: 179 RSRDTEAESALGATYVSFEELLQQSDFVVCLAPFTEETAGMFNAKAFQTMKSSAMFINAS 238 Query: 241 RGAVVDTNALIKALKEGWIAGAGLDVFEEEPYYNEE-LFKLKNVVLAPHIGSATHEAREG 299 RGA V L +AL G IAGAGLDVF +EP N+ L LK VV PHIGSA+ E R+ Sbjct: 239 RGANVVEEDLYEALVAGDIAGAGLDVFTKEPIANDHPLLTLKQVVALPHIGSASVETRQA 298 Query: 300 MAELVAKNLIAFAKGEIP 317 M L +N+ G+ P Sbjct: 299 MMHLCLENINLVLSGQQP 316 Lambda K H 0.317 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 249 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 321 Length adjustment: 28 Effective length of query: 303 Effective length of database: 293 Effective search space: 88779 Effective search space used: 88779 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory