Align 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43) (characterized)
to candidate WP_036835917.1 N784_RS14115 phosphoglycerate dehydrogenase
Query= reanno::BFirm:BPHYT_RS11290 (321 letters) >NCBI__GCF_000775615.1:WP_036835917.1 Length = 528 Score = 183 bits (465), Expect = 7e-51 Identities = 98/275 (35%), Positives = 156/275 (56%), Gaps = 5/275 (1%) Query: 46 IGSSVKITPAMLEGATRLKALSTISVGFDQFDVADLTRRGIVLANTPDVLTESTADTVFS 105 + S +T +LE T LK + VG D D+ T +GI++ N PD T STA+ F+ Sbjct: 50 VRSQTTVTKELLEAGTNLKVIGRAGVGVDNIDLEAATEQGIIVVNAPDGNTISTAEHTFA 109 Query: 106 LILASARRVVELAEWVKAGHWQHSIGPALFGVDVQGKTLGIVGLGRIGGAVARRAALGFN 165 +++A AR + + + + G W + GV++ KTLGI+G+GRIG VARRA Sbjct: 110 MMMALARHIPQAYQTLMNGKWDRK---SFKGVELHRKTLGIIGMGRIGSEVARRAK-ACR 165 Query: 166 MKVLYTNRSANPQAEEAYGARRVELAELLATADFVCLQVPLTPETKHLIGAAELKSMKKS 225 M ++ + + + G + L ++ AT+DF+ + PLT ETKH+I MK+ Sbjct: 166 MTIIAYDPFLTEERADKLGITKGSLEDIYATSDFITVHTPLTKETKHMIDDNAFTKMKQG 225 Query: 226 AILINASRGATVDEKALIEALQNGTIHGAGLDVFETEPLPSDSPLLKLANVVALPHIGSA 285 ++N +RG ++E AL+ A+++G + GA LDVFE EP D PLL V+A PH+G++ Sbjct: 226 VRILNCARGGIIEEGALLRAIESGIVAGAALDVFEKEP-AMDHPLLDRPEVIATPHLGAS 284 Query: 286 THETRHAMARNAAENLVAALDGTLTSNIVNREVLS 320 T E + +A++ +E ++A L+G N VN +S Sbjct: 285 TEEAQTLVAQDVSEEIIAILNGESFKNAVNMPTIS 319 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 304 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 528 Length adjustment: 31 Effective length of query: 290 Effective length of database: 497 Effective search space: 144130 Effective search space used: 144130 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory