Align Phosphate propanoyltransferase; Phosphate acyltransferase PduL; Phosphotransacylase PduL; PTAC; Propanediol utilization protein PduL; EC 2.3.1.222 (characterized)
to candidate WP_052127369.1 N784_RS15075 phosphate propanoyltransferase
Query= SwissProt::Q9XDN5 (210 letters) >NCBI__GCF_000775615.1:WP_052127369.1 Length = 194 Score = 175 bits (443), Expect = 6e-49 Identities = 93/171 (54%), Positives = 119/171 (69%), Gaps = 2/171 (1%) Query: 27 SNRHIHLSAQDYERLF-PGHPISEKKALLQPGQYAAEQTVTLVGPKGQLKNVRLLGPLRS 85 S RHIHL + LF G+ +++ K L QPGQ+A ++ VT+VGPKG+LKNV +LGP R Sbjct: 11 SGRHIHLDRPTIDALFGKGYQLTKAKDLSQPGQFACKERVTIVGPKGELKNVVILGPERK 70 Query: 86 VSQVEISRTDARTLGIAAPLRMSGNLKGTPGIRLVSPFAELELPSGVIVAQRHIHMSPLD 145 SQVE+S TDAR LG+ P+R SG++KGTPGI LVS +EL G I A+RH+HMSP D Sbjct: 71 KSQVEVSLTDARALGVQVPVRESGDIKGTPGITLVSGDQRVELTEGCIAAKRHVHMSPSD 130 Query: 146 ALILRVSHGDMVSVAIEGDDRGLIFNNVAIRVSPDMRLEMHIDTDEANAAG 196 A +V ++V V + G DR LIF++V IRV P+ R MHID DEANA G Sbjct: 131 AKRFQVEDKEIVQVKVMG-DRPLIFDDVVIRVHPNYRTYMHIDIDEANACG 180 Lambda K H 0.319 0.136 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 155 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 210 Length of database: 194 Length adjustment: 21 Effective length of query: 189 Effective length of database: 173 Effective search space: 32697 Effective search space used: 32697 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory