Align Glycerol facilitator (characterized)
to candidate WP_036834317.1 N784_RS09105 aquaporin family protein
Query= TCDB::P18156 (274 letters) >NCBI__GCF_000775615.1:WP_036834317.1 Length = 276 Score = 343 bits (880), Expect = 2e-99 Identities = 158/267 (59%), Positives = 201/267 (75%), Gaps = 1/267 (0%) Query: 1 MTAFWGEVIGTMLLIIFGAGVCAGVNLKKSLSFQSGWIVVVFGWGLGVAMAAYAVGGISG 60 MT F E+IGTM+LIIFG GV GV LKKS + +GW+++ GWGL V M YAVG +SG Sbjct: 1 MTEFLAELIGTMILIIFGGGVVGGVVLKKSKAEGTGWVLITLGWGLAVTMGVYAVGNVSG 60 Query: 61 AHLNPALTIALAFVGDFPWKEVPVYIAAQMIGAIIGAVIIYLHYLPHWKSTDDPAAKLGV 120 AH+NPA+TI A +G+FPW +VP ++A Q IGA +G VI++L+YLPHW +T+D AKL V Sbjct: 61 AHINPAVTIGFAMIGEFPWSQVPTFLAGQFIGAFLGGVIVFLNYLPHWNATEDKGAKLAV 120 Query: 121 FSTGPSIPHTFANVLSEVIGTFVLVLGILAIGANQFTEGLNPLIVGFLIVAIGISLGGTT 180 FST P+I +N +SE+IGTF+LV+G+L IGAN+FT+GLNP IVG LIVAIG+SLGG T Sbjct: 121 FSTDPAINSPLSNFVSEIIGTFMLVMGLLFIGANEFTQGLNPFIVGLLIVAIGMSLGGAT 180 Query: 181 GYAINPARDLGPRIAHAFLPIPGKGSSNWKYAWVPVVGPILGGSFGGVFYNAAFKGHITS 240 GYAINPARD+GPRIAH LPIPGKG SNW YAWVP+ GPI+GG +G +FY A F G + Sbjct: 181 GYAINPARDIGPRIAHMLLPIPGKGGSNWGYAWVPLFGPIVGGVYGALFYKAIFTGEYSV 240 Query: 241 SFWIVSVILVVVLLGLYVYTKSHSAKT 267 +FW + I++ + L L + AKT Sbjct: 241 TFWAFTAIILAIFL-LAAQKEIQKAKT 266 Lambda K H 0.325 0.142 0.451 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 383 Number of extensions: 22 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 274 Length of database: 276 Length adjustment: 25 Effective length of query: 249 Effective length of database: 251 Effective search space: 62499 Effective search space used: 62499 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory