Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_036834324.1 N784_RS09125 ABC transporter ATP-binding protein
Query= uniprot:A0A165KC86 (260 letters) >NCBI__GCF_000775615.1:WP_036834324.1 Length = 310 Score = 120 bits (302), Expect = 3e-32 Identities = 76/249 (30%), Positives = 139/249 (55%), Gaps = 25/249 (10%) Query: 9 VLKVAGISKRFGGLQALSDVGITIKRGQVYGLIGPNGAGKTTFFNVITGLYTPDAGTFEL 68 +L++ +SK+F A+ ++ + I+RG+V GL+GPNGAGK+T ++++ L TP G Sbjct: 1 MLELVDLSKKFHQTYAVKNMNMFIERGEVIGLLGPNGAGKSTAISMMSSLITPTTGDVRY 60 Query: 69 AGKPY--EPTAVHEVAKAGIARTFQNIRLFAEMTALENVMVGRHIRTGSGLFGAVFRTKG 126 K P+ + +V GI Q I L+ ++TA EN+ FG +++ KG Sbjct: 61 LHKSILKSPSPLRKV--TGIVP--QEIALYDDLTAEENL----------AFFGRIYQLKG 106 Query: 127 FKAEEAAIAKRAQELLDYVGIGKFADYKARTLSYGDQRRLEIARALATDPQLIALDEPAA 186 A+ +R ++LD +G+ + + + S G +RRL I AL +P+L+ +DEP Sbjct: 107 -----KALKRRIADVLDVIGLTQRSKDLVKEYSGGMKRRLNIGVALLHEPELLIMDEPTV 161 Query: 187 GMNATEKVQLRELIDRIRND-NRTILLIEHDVKLVMGLCDRVTVLDYGKQIAEGNPAEVQ 245 G++ + + E + R+ + N T++ H ++ V LC+R+ ++D G+ IA G+ E++ Sbjct: 162 GIDPQSRTHILETVQRLNTEKNMTVIYTSHYMEEVEFLCNRIYIMDQGQLIAAGSKEELK 221 Query: 246 K---NEKVI 251 + +EK+I Sbjct: 222 QILSSEKII 230 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 180 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 310 Length adjustment: 26 Effective length of query: 234 Effective length of database: 284 Effective search space: 66456 Effective search space used: 66456 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory