Align glycine betaine/l-proline transport atp-binding protein prov (characterized)
to candidate WP_036835185.1 N784_RS11890 ABC transporter ATP-binding protein
Query= CharProtDB::CH_001555 (400 letters) >NCBI__GCF_000775615.1:WP_036835185.1 Length = 371 Score = 170 bits (430), Expect = 7e-47 Identities = 87/223 (39%), Positives = 141/223 (63%), Gaps = 6/223 (2%) Query: 42 LGVKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELR 101 L V L + +GE V++G SG GKST +R++ L + G ++++G +++D Sbjct: 17 LAVDQIDLQVNDGEFVVLVGPSGCGKSTTLRMIAGLESISSGDLILNGT---RLNDTHSS 73 Query: 102 EVRRKKIAMVFQSFALMPHMTVLDNTAFGMELAGINAEERREKALDALRQVGLENYAHSY 161 + +AMVFQS+AL PHM+V +N AFGM++ +N +++ A + + LEN + Sbjct: 74 N---RNMAMVFQSYALYPHMSVFENIAFGMKVRKVNKNIIKQEVEKAAKILQLENLLNRK 130 Query: 162 PDELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTIVFI 221 P ELSGG +QRV + RAL P++ LMDE S LD +RT+M+ E+ +LQ K + T++++ Sbjct: 131 PGELSGGQKQRVAIGRALVREPEVFLMDEPLSNLDAKLRTKMRSEIKELQQKLKATMIYV 190 Query: 222 SHDLDEAMRIGDRIAIMQNGEVVQVGTPDEILNNPANDYVRTF 264 +HD EAM +GD+I +M++G+V Q+G P ++ N P N +V F Sbjct: 191 THDQVEAMTMGDKIVVMKDGQVQQIGAPVDVYNKPINRFVGGF 233 Lambda K H 0.319 0.137 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 303 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 371 Length adjustment: 30 Effective length of query: 370 Effective length of database: 341 Effective search space: 126170 Effective search space used: 126170 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory