Align iron(III) dicitrate transport ATP-binding protein FecE (characterized)
to candidate WP_049990591.1 LT39_RS11195 ATP-binding cassette domain-containing protein
Query= CharProtDB::CH_088321 (255 letters) >NCBI__GCF_000784335.1:WP_049990591.1 Length = 446 Score = 202 bits (513), Expect = 1e-56 Identities = 106/247 (42%), Positives = 155/247 (62%) Query: 2 TLRTENLTVSYGTDKVLNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMPQSGTVFL 61 T+ ++L++S+G VL VSLS+ G+ L+GPNG GK+TLL S L P SGTV + Sbjct: 9 TITVDDLSLSFGDVSVLERVSLSIEPGEFVGLVGPNGAGKTTLLRAISGSLAPDSGTVTV 68 Query: 62 GDNPINMLSSRQLARRLSLLPQHHLTPEGITVQELVSYGRNPWLSLWGRLSAEDNARVNV 121 I+ +SSR +R ++++PQ V+++V GR+P S + ED A V Sbjct: 69 DGVDIHGVSSRTSSRLVAVVPQDTSLSFSFPVRDVVEMGRHPHRSRFSSPGPEDRAAVER 128 Query: 122 AMNQTRINHLAVRRLTELSGGQRQRAFLAMVLAQNTPVVLLDEPTTYLDINHQVDLMRLM 181 A+++TR LA R + E+SGGQRQR LA +AQ TPV+LLDEPT LD+NHQV+ + L+ Sbjct: 129 ALDRTRTTDLADRPIDEVSGGQRQRVVLARAIAQATPVMLLDEPTASLDVNHQVETLELV 188 Query: 182 GELRTQGKTVVAVLHDLNQASRYCDQLVVMANGHVMAQGTPEEVMTPGLLRTVFSVEAEI 241 +L G+T +A +HDL+ A+RYCD+LV++A+G V G P +V+T L F A + Sbjct: 189 RDLVADGRTAIAAIHDLDLAARYCDRLVLLADGAVSRDGPPSDVLTGDALAESFDATAVV 248 Query: 242 HPEPVSG 248 P P++G Sbjct: 249 TPNPITG 255 Lambda K H 0.320 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 249 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 446 Length adjustment: 28 Effective length of query: 227 Effective length of database: 418 Effective search space: 94886 Effective search space used: 94886 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory