Align iron(III) dicitrate transport ATP-binding protein FecE (characterized)
to candidate WP_143067735.1 LT39_RS05240 amino acid ABC transporter ATP-binding protein
Query= CharProtDB::CH_088321 (255 letters) >NCBI__GCF_000784335.1:WP_143067735.1 Length = 281 Score = 113 bits (283), Expect = 4e-30 Identities = 70/225 (31%), Positives = 120/225 (53%), Gaps = 5/225 (2%) Query: 3 LRTENLTVSYGTDKVLNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMPQSGTVFLG 62 LR E+L SYG ++VL VSL + G + L+GP+G GKSTLL C +RL SG ++LG Sbjct: 39 LRIEDLHKSYGAEEVLQGVSLEIDRGDVEVLVGPSGSGKSTLLRCLNRLTEIDSGRLYLG 98 Query: 63 DNPINMLSS--RQLARRLSLLPQHHLTPEGITVQELVSYGRNPWLSLWGRLSAEDNARVN 120 + + ++ +++ ++ Q +T +E V+ G + G A+ R + Sbjct: 99 VTEVTAPDADPNEIRQQIGMVFQDINLFTHLTARENVTLGLR---KVRGMDEAKARERAD 155 Query: 121 VAMNQTRINHLAVRRLTELSGGQRQRAFLAMVLAQNTPVVLLDEPTTYLDINHQVDLMRL 180 +++ + A +LSGGQ+QR +A LA + V+L DEPT+ LD +++ + Sbjct: 156 AELDRVGLADQADSYPAQLSGGQKQRVGIARALAMDPEVMLFDEPTSALDPELSNEVLAV 215 Query: 181 MGELRTQGKTVVAVLHDLNQASRYCDQLVVMANGHVMAQGTPEEV 225 M EL +G T+V V H++ A + + +G ++ +G PE + Sbjct: 216 MDELVAEGMTMVVVTHEMRFARGAATGITFLDDGQIVERGPPERL 260 Lambda K H 0.320 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 171 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 281 Length adjustment: 25 Effective length of query: 230 Effective length of database: 256 Effective search space: 58880 Effective search space used: 58880 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory