Align GlpP, component of Glycerol uptake porter, GlpSTPQV (characterized)
to candidate WP_049988752.1 LT39_RS01710 sugar ABC transporter permease
Query= TCDB::G3LHZ0 (288 letters) >NCBI__GCF_000784335.1:WP_049988752.1 Length = 312 Score = 147 bits (371), Expect = 3e-40 Identities = 93/275 (33%), Positives = 151/275 (54%), Gaps = 12/275 (4%) Query: 12 LVLPVLLLVAFSAVIPLMTVVNYSVQDT--FGNNEFFWAGTDWFVQTLHSDRFWESLQRN 69 L+ P +L++ +++PL+ ++ S + +E + G + + Q + + S + Sbjct: 32 LLAPSVLVLGILSIVPLIALLWLSAMEVNFLPGHEPTFVGLENY-QAMFNSTVANSWKVT 90 Query: 70 LLFSFIILALEIPLGIFIALNMPKSGPGVPVCLVLMALPLLIPWNVVGTIWQVFGRVDIG 129 + + L+L+I LG IAL + + G V ++ +P++I VVG +WQ G Sbjct: 91 VFYIVGALSLQITLGTAIALLLDRVSRGENVLTGIIIMPMMIAPVVVGLLWQFLLDPSFG 150 Query: 130 LLGHTLEAIGLDYNYVRDPI-----DAWVTVIVMDVWHWTSLVVLLCYAGLVSIPDAYYQ 184 L L IGL + PI A + VIVMD W WT LVVL+ AGL ++P Y+ Sbjct: 151 LYTWLLNQIGL---FTESPILGSQPSALIAVIVMDTWQWTPLVVLIVLAGLKAVPRQLYE 207 Query: 185 AAKIDGASRWSVFRYIQLPKMKRVLLIAVLLRFMDSFMIYTEPFVVTGGGPGNSTTFLSI 244 AA++DGA+ W+ FRY+ LP +K L IA+LLR MD +T+ F+ TGGGP +ST + Sbjct: 208 AARVDGATFWTEFRYVTLPMLKPALAIALLLRSMDLIRYFTKIFITTGGGPASSTKIIGF 267 Query: 245 DLVKMAVGQFDLGPAAAMSIIYFLIILLLSWVFYT 279 + + ++ ++LG AAM I LI+ +L +F+T Sbjct: 268 LVYEESLRFYNLGYGAAMG-IGMLIVTVLLGIFFT 301 Lambda K H 0.329 0.143 0.464 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 262 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 312 Length adjustment: 27 Effective length of query: 261 Effective length of database: 285 Effective search space: 74385 Effective search space used: 74385 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory