Align glucose transporter, ATPase component (characterized)
to candidate WP_049988549.1 LT39_RS00685 ATP-binding cassette domain-containing protein
Query= reanno::Phaeo:GFF3641 (260 letters) >NCBI__GCF_000784335.1:WP_049988549.1 Length = 369 Score = 97.8 bits (242), Expect = 3e-25 Identities = 65/218 (29%), Positives = 109/218 (50%), Gaps = 8/218 (3%) Query: 16 VEMKDISISFGGIKAVDHVSVDLYPGEVVGLLGHNGAGKSTLIKVLSGAYQMDAGEIRVN 75 + + ++ F G+ AVD +S + GE+ GLLG NGAGKSTLI +L +G VN Sbjct: 4 IHVDGLTKEFDGVTAVDDLSFTVERGELFGLLGPNGAGKSTLINMLVALLPPSSGTASVN 63 Query: 76 GDKVEITNPRDARSHNIETIYQTLALADNLDAASNLFLGRELVTPFGLVDDSAMEAECRK 135 G ++ + + A ++ ++Q AL + L A NL L +G + + Sbjct: 64 GH--DVRSEKGAVRSSLGIVFQEPALDEELTGAENLAFHSRL---YGQARSDRAD-RIDE 117 Query: 136 IMNRLNPNFQKFSEPVSALSGGQRQSVAIARAVYFNAKILIMDEPTAALGPHETQMVAEL 195 ++ + + + +PV SGG ++ + IAR + +L +DEPT L + E Sbjct: 118 VLGLVGLSAVR-DDPVGTYSGGMKRRLEIARGLLHEPAVLFLDEPTVGLDARTRRDTWEY 176 Query: 196 IQQL-KAQGIGIFLIDHDVNAVMELCDRASVMKNGQLV 232 I+QL +A G+ I L H + LCDR +++ +G +V Sbjct: 177 IEQLNEAAGVSIVLTTHYIEEADRLCDRVAIVDDGDIV 214 Lambda K H 0.317 0.135 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 219 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 369 Length adjustment: 27 Effective length of query: 233 Effective length of database: 342 Effective search space: 79686 Effective search space used: 79686 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory