Align Inner membrane ABC transporter permease protein (characterized, see rationale)
to candidate WP_049991787.1 LT39_RS17480 carbohydrate ABC transporter permease
Query= uniprot:A8LLL4 (385 letters) >NCBI__GCF_000784335.1:WP_049991787.1 Length = 288 Score = 99.8 bits (247), Expect = 9e-26 Identities = 66/209 (31%), Positives = 114/209 (54%), Gaps = 8/209 (3%) Query: 180 NTLTVTIPATIIPILVAAFAAYALAWMEFPGRALLIALIVGLLVVPLQLALIPLLTLHNA 239 NT+ + TI+ +L+ A AY+L +++PGR + A+IV +VP + L+P+ + + Sbjct: 85 NTVILAGVTTIVVMLIDAMIAYSLTRLDWPGRRAIFAVIVASFMVPGIVNLVPVYIIVSE 144 Query: 240 IGIGKGYLGTWLAHTGFGMPLAIYLLRNYMVGLPRDIIENAKVDGATDFQIFTKIVLPLS 299 +G+ G L PL +++L + +P ++ E A++DG + ++F+ IVLPL Sbjct: 145 LGLVNSVWGVVLPSAA--NPLGVFMLVQFFKDIPEELEEAARLDGFSRLRVFSHIVLPLM 202 Query: 300 FPALASFAIFQFLWTWNDLL-VAKVFLIDATGQTTVMTNQIVELLG-TRGGNWEILATAA 357 ALA+ +F F+WTWN + +F DA + + + LG T G ++ T+A Sbjct: 203 RSALAALGLFIFIWTWNAFVWPLLIFQDDAMYTLPIGLVTLQDNLGVTEPG---VIMTSA 259 Query: 358 FVSIAVPLLVFFSMQRFLVRGL-LAGSVK 385 V+ LLVF MQ+ LVR + + G+ K Sbjct: 260 VVASVPLLLVFLVMQKHLVRAVEMQGTTK 288 Lambda K H 0.323 0.138 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 267 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 288 Length adjustment: 28 Effective length of query: 357 Effective length of database: 260 Effective search space: 92820 Effective search space used: 92820 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory