Align D-serine/D-alanine/glycine transporter (characterized)
to candidate WP_039103680.1 FPB0191_RS02210 amino acid permease
Query= SwissProt::A0A0H2VDI7 (470 letters) >NCBI__GCF_000807275.1:WP_039103680.1 Length = 484 Score = 257 bits (656), Expect = 7e-73 Identities = 145/398 (36%), Positives = 230/398 (57%), Gaps = 20/398 (5%) Query: 16 EQSLRRNLTNRHIQLIAIGGAIGTGLFMGSGKTISLAGPS-IIFVYMIIGFMLFFVMRAM 74 + L+R+L RH+ +IAIGG+IGTGLF+ SG TI+ AGP+ + Y IIG M++F+M ++ Sbjct: 2 QNKLKRDLKARHLTMIAIGGSIGTGLFVASGATIAQAGPAGSLLSYAIIGVMVYFLMTSL 61 Query: 75 GELLLSNLEYKSFSDFASDLLGPWAGYFTGWTYWFCWVVTGMADVVAITAYAQFWFP-GL 133 GEL +F+ + S + G+ GW YW+ W +T D+VA +WF G Sbjct: 62 GELAAYLPVSGTFATYGSKYVDESFGFAIGWNYWYNWAITVAVDLVAAQLVISYWFDFGA 121 Query: 134 SDWVASLSVIILLLVLNLATVKMFGEMEFWFAMIKIVAIVSLIVVGLVMVA--MHFQSPT 191 W+ SL ++++ LN+ +VK FGE EFWF++IK++ +V I VGL+M+ +H S T Sbjct: 122 YSWLWSLLFLVIIFFLNVISVKGFGEAEFWFSLIKVITVVVFIAVGLLMIVGILHGGSDT 181 Query: 192 GVEASFAHLWNDGGW-FPKGLSGFFAGFQIAVFAFVGIELVGTTAAETKDPEKSLPRAIN 250 + H WN G F G S I F+F G EL+G A E+KDPEK++P+++ Sbjct: 182 AIGW---HNWNIGDAPFVGGFSSMIGVAMIVGFSFQGTELIGIAAGESKDPEKNIPKSMR 238 Query: 251 SIPIRIIMFYVFSLIVIMSVTPWSS--------VVPEKSPFVELFVLVGLPAAASVINFV 302 + RI++FY+F++ VI + P++ SPF +F GL +AA+++N V Sbjct: 239 QVFWRILLFYIFAIFVISLIIPYTDPRLLRNDEADISVSPFTLVFEHAGLLSAAAIMNAV 298 Query: 303 VLTSAASSANSGVFSTSRMLFGLAQEGVAPKAFAKLSKRAVPAKGL-TFSCICLLGGVVM 361 VLTS S+ NSG+++++RML+ LA+EG APK F +LSK +P L + + +L + Sbjct: 299 VLTSVLSAGNSGLYASTRMLYALAKEGKAPKIFGRLSKSGIPTMSLIATTIVAMLCFLTS 358 Query: 362 LYVNPSVIGAFTMITTVSAILFMFVWTIILCSYLVYRK 399 ++ + V + + +S + W I S+ +RK Sbjct: 359 MFKDQQV---YLWLLNLSGMTGFIAWLGIAISHYRFRK 393 Lambda K H 0.329 0.141 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 629 Number of extensions: 43 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 470 Length of database: 484 Length adjustment: 33 Effective length of query: 437 Effective length of database: 451 Effective search space: 197087 Effective search space used: 197087 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory