Align Glyoxylate reductase; EC 1.1.1.26 (uncharacterized)
to candidate WP_039104088.1 FPB0191_RS03575 2-hydroxyacid dehydrogenase
Query= curated2:B1L765 (332 letters) >NCBI__GCF_000807275.1:WP_039104088.1 Length = 334 Score = 161 bits (408), Expect = 2e-44 Identities = 105/336 (31%), Positives = 168/336 (50%), Gaps = 21/336 (6%) Query: 1 MKPRVFVTREIPERGLSKIEEHFELDLWKDEAPPSKKVIIERVKDCDALVSLLTDPIDAE 60 +K VF ++ L +HF ++ E S K + K DA+ + D +D + Sbjct: 5 VKVAVFSSKHYDREHLDLANKHFGFEIEYYEHKFSCKTAVT-AKGFDAVCVFVNDQVDKK 63 Query: 61 VFE--AAPKLRIVAQYAVGYDNIDVKEATKRGIYVTNTPGVLTETTADFAFALLMAAARR 118 AA ++I+A G+DN+D++ A K GI V P E A+ A AL+M RR Sbjct: 64 ALHELAAVGVKILALRCAGFDNVDLEAAEKLGITVVRVPAYSPEAVAEHAVALMMTLNRR 123 Query: 119 VVEADRYVREGKWKVAWHPMMMLGYDVYGRTLGIVGMGRIGAAVARRAKGFGMRILYYDS 178 +A + R+ + + + G++++ RT G++G G+IG A+ R KGFGM IL YD Sbjct: 124 THKAYQRTRDANFALDG----LTGFNMHNRTAGVIGTGKIGLAIIRILKGFGMNILAYDP 179 Query: 179 IRREDFEKELGVEYVPLEKLLEESDFVSLHVPLTEETYHMIGEEQLRRMKRTAILVNTSR 238 D ELG YV L++L +SD ++LH P++ E YH++ + +MK+ +++NTSR Sbjct: 180 YPN-DTAVELGASYVNLDELYAKSDVITLHCPMSPENYHLLNADAFSKMKQGVMIINTSR 238 Query: 239 GKVVDQKALYKALKEGWIAGAGLDVFEQE----------PIPPDDPLLKL---ENVVLAP 285 G ++D A ALK+ I G+DV+E E + DD +L NV+ Sbjct: 239 GGLLDATAAIDALKQTKIGALGMDVYENERELFFEDKSNDVILDDVFRRLSSCHNVIFTG 298 Query: 286 HAASASHETRSRMAEMVAENLIAFKRGEIPPNLVNQ 321 H A + E ++E N+ A G N+V + Sbjct: 299 HQAFLTQEALLNISETTLSNIQAVYEGAACNNIVKK 334 Lambda K H 0.319 0.137 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 252 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 334 Length adjustment: 28 Effective length of query: 304 Effective length of database: 306 Effective search space: 93024 Effective search space used: 93024 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory