Align 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43) (characterized)
to candidate WP_039103118.1 FPB0191_RS00075 phosphoglycerate dehydrogenase
Query= reanno::BFirm:BPHYT_RS11290 (321 letters) >NCBI__GCF_000807275.1:WP_039103118.1 Length = 413 Score = 130 bits (326), Expect = 7e-35 Identities = 94/283 (33%), Positives = 141/283 (49%), Gaps = 11/283 (3%) Query: 38 ALKDADG-GIGSSVKITPAMLEGATRLKALSTISVGFDQFDVADLTRRGIVLANTPDVLT 96 A+KDA G+ S ++T ++ A +L + +G +Q +++ +++GI + N P T Sbjct: 50 AIKDARFIGVRSRTQLTEDIINCAPKLAGIGCFCIGTNQVNLSAASKKGIPVFNAPFSNT 109 Query: 97 ESTADTVFSLILASARRVVELAEWVKAGHWQHSIGPALFGVDVQGKTLGIVGLGRIGGAV 156 S A+ V + I+ RRV E G W A+ + +GK+LGI+G G IG + Sbjct: 110 RSVAELVLAEIILLLRRVPEANAQAHLGKWNKI---AIGSHETRGKSLGIIGYGHIGSQL 166 Query: 157 ARRAALGFNMKVLYTNRSANPQAEEAYGARRVELAELLATADFVCLQVPLTPETKHLIGA 216 + A MKV + + A + LA L A +D + L VP T ++I Sbjct: 167 SVLAE-SLGMKVFFYDIETKLPLGNA--KQMPSLAALFAESDVISLHVPENATTINMISK 223 Query: 217 AELKSMKKSAILINASRGATVDEKALIEALQNGTIHGAGLDVFETEPL----PSDSPLLK 272 EL+ MK +IL+NASRG VD +AL AL + I GA +DVF +EP P SPL + Sbjct: 224 KELEMMKPRSILVNASRGKVVDIEALANALADKHIAGAAIDVFPSEPASNSEPFTSPLCQ 283 Query: 273 LANVVALPHIGSATHETRHAMARNAAENLVAALDGTLTSNIVN 315 NV+ PHIG +T E + + A L D T + VN Sbjct: 284 FDNVIITPHIGGSTIEAQENIGIEVATKLAKYSDTGSTLSAVN 326 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 265 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 413 Length adjustment: 29 Effective length of query: 292 Effective length of database: 384 Effective search space: 112128 Effective search space used: 112128 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory