Align 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43) (characterized)
to candidate WP_039104475.1 FPB0191_RS05230 D-2-hydroxyacid dehydrogenase
Query= reanno::BFirm:BPHYT_RS11290 (321 letters) >NCBI__GCF_000807275.1:WP_039104475.1 Length = 314 Score = 137 bits (344), Expect = 4e-37 Identities = 94/284 (33%), Positives = 144/284 (50%), Gaps = 13/284 (4%) Query: 30 TQHDAF-VAALKDADGGIGSSVKITPAMLEGATRLKALSTISVGFDQFDVADLTRRGIVL 88 T H F V A KD I + V+IT + LK ++ S GF+ D++ IV+ Sbjct: 32 TDHGVFDVIAGKDII--ITNKVRITRDHMVANPELKMIAVASTGFNHIDISAAREFNIVV 89 Query: 89 ANTPDVLTESTADTVFSLILASARRVVELAEWVKAGHWQHSIGPALFGVD---VQGKTLG 145 N T+S A+ ++LA + ++ +++ G WQ S ++ G D + GK L Sbjct: 90 TNVKSYSTQSVAEHTMMMMLALSHQLFVYNTFIREGKWQKSAFYSISGPDYFELMGKILV 149 Query: 146 IVGLGRIGGAVARRAALGFNMKVLYTNRSANPQAEEAYGARRVELAELLATADFVCLQVP 205 I+G G G AVA+ A F M VL++ R Y V E L+ AD + L P Sbjct: 150 IIGKGDTGRAVAKLAK-AFGMTVLFSERKGAESCRSGY----VPFEEALSLADVLTLHCP 204 Query: 206 LTPETKHLIGAAELKSMKKSAILINASRGATVDEKALIEALQNGTIHGAGLDVFETEPLP 265 L T +LIG+ EL+ MKK+A+LIN RG +E++L+ +L+ I GAG DV EP Sbjct: 205 LNETTVNLIGSNELEQMKKTALLINVGRGGLANEQSLVNSLRRSDIAGAGFDVLCEEPPK 264 Query: 266 SDSPLLK--LANVVALPHIGSATHETRHAMARNAAENLVAALDG 307 + SPLL+ L N + PH+ + E+ + ++NL + + G Sbjct: 265 NGSPLLQEDLGNFIITPHLACRSSESFQRLVEGLSDNLNSFVAG 308 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 314 Length adjustment: 27 Effective length of query: 294 Effective length of database: 287 Effective search space: 84378 Effective search space used: 84378 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory