Align UDP-glucose 4-epimerase (EC 5.1.3.2); UDP-N-acetylglucosamine 4-epimerase (EC 5.1.3.7) (characterized)
to candidate WP_039103631.1 FPB0191_RS01985 ADP-glyceromanno-heptose 6-epimerase
Query= BRENDA::Q9WYX9 (309 letters) >NCBI__GCF_000807275.1:WP_039103631.1 Length = 308 Score = 89.7 bits (221), Expect = 8e-23 Identities = 73/245 (29%), Positives = 121/245 (49%), Gaps = 17/245 (6%) Query: 3 ILVTGGAGFIGSHVVDKLIENGY-GVIVVDNLSSGKVENLNRNALFYEQSIEDEEMMERI 61 I+VTGGAGFIGS++V L G ++VVD+L+ G + N L ++ +E + I Sbjct: 2 IIVTGGAGFIGSNIVKGLNAIGRTDILVVDDLTDG-TKFANLADLDIADYMDKDEFISLI 60 Query: 62 FSLHRP--EYVFHLAAQASVAISVREPARDAKTNIIGSLVLLEKSIKYGVKK---FIFSS 116 S E +FH A +S D K + + + + Y + + F+++S Sbjct: 61 VSDEDLDIEVIFHEGACSSTT------EWDGKFMMENNYSYSKDLLHYCLDRRIPFLYAS 114 Query: 117 TGGAIYGENVKVFPTPETEIPHPISPYGIAKYSTEMYLEFFAREYGLKYTVLRYANVYGP 176 + A YG + F + + P++ YG +K+ + Y+ + + RY NVYGP Sbjct: 115 SA-ATYGGCSENF-IEDRQFEKPLNVYGYSKFLFDQYVRTILPKAKSQVCGFRYFNVYGP 172 Query: 177 RQDPYGEAGVVAI-FTERMLRGEEVHIF-GDGEYVRDYVYVDDVVRANLLAMEKGDNEVF 234 R+ G VA ++++GE+ +F G + RD++YVDDVV N+ E + +F Sbjct: 173 REQHKGSMASVAFHLNSQLIKGEKPKLFEGSDNFQRDFIYVDDVVAVNIWFWENNQSGIF 232 Query: 235 NIGTG 239 N GTG Sbjct: 233 NCGTG 237 Lambda K H 0.318 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 235 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 308 Length adjustment: 27 Effective length of query: 282 Effective length of database: 281 Effective search space: 79242 Effective search space used: 79242 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory