Align Fructokinase; D-fructose kinase; Manno(fructo)kinase; EC 2.7.1.4 (characterized)
to candidate WP_039104924.1 FPB0191_RS06935 N-acetylglucosamine kinase
Query= SwissProt::P23917 (302 letters) >NCBI__GCF_000807275.1:WP_039104924.1 Length = 308 Score = 176 bits (447), Expect = 5e-49 Identities = 104/299 (34%), Positives = 153/299 (51%), Gaps = 1/299 (0%) Query: 1 MRIGIDLGGTKTEVIALGDAGEQLYRHRLPTPRDDYRQTIETIATLVDMAEQATGQRGTV 60 M G D+GGTK E+ D +Q++ R+ TP D Y+ + + +LV+ A+ +G + Sbjct: 1 MLYGFDIGGTKIELAVFDDELKQVWSKRVDTPTDSYQSFLACLVSLVNEADDRFAVKGQI 60 Query: 61 GMGIPGSISPYTGVVKNANSTWLNGQPFDKDLSARLQREVRLANDANCLAVSEAVDGAAA 120 G+GIPG I+ V N + P DL + R + + NDANC A+SEA A Sbjct: 61 GIGIPGIINEKDKTVYTTNIDAVKNMPLINDLEQAIHRPISVNNDANCFALSEAYYKAFK 120 Query: 121 GAQTVFAVIIGTGCGAGVAFNGRAHIGGNGTAGEWGHNPLPWMDEDELRYR-EEVPCYCG 179 + V VI+GTG G G+ N + G +G GE GH L L Y V C CG Sbjct: 121 HYKNVLGVILGTGLGGGLVINHQLVNGADGCGGEIGHVGLSINMLKILGYDIPLVKCGCG 180 Query: 180 KQGCIETFISGTGFAMDYRRLSGHALKGSEIIRLVEESDPVAELALRRYELRLAKSLAHV 239 +GC E ++SGTGF Y L I+ D A + RY LA LA++ Sbjct: 181 LEGCCERYLSGTGFEWLYHHFYHKQLSAKTILEHYYNGDNDALAHVDRYLELLAAYLANI 240 Query: 240 VNILDPDVIVLGGGMSNVDRLYQTVGQLIKQFVFGGECETPVRKAKHGDSSGVRGAAWL 298 + + +P++IV+GGG+SN D +Y V + + +++ + KAK+GD+ G RGAA L Sbjct: 241 MMVTNPEIIVIGGGLSNFDLIYHEVPKRLPKYLLPRMTVPRIEKAKYGDAGGARGAALL 299 Lambda K H 0.318 0.137 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 307 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 308 Length adjustment: 27 Effective length of query: 275 Effective length of database: 281 Effective search space: 77275 Effective search space used: 77275 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory