Align fructokinase (EC 2.7.1.4) (characterized)
to candidate WP_039105873.1 FPB0191_RS10250 hypothetical protein
Query= BRENDA::C4M2I2 (294 letters) >NCBI__GCF_000807275.1:WP_039105873.1 Length = 294 Score = 174 bits (440), Expect = 3e-48 Identities = 92/291 (31%), Positives = 163/291 (56%), Gaps = 3/291 (1%) Query: 6 IKVAGIGEVVWDCFGDVKKQGGAPCNFAMHMAQFGFESYAFIAVGNDELGKRSLEIIHSF 65 +K+ +GE +WD + KK GGA NF H G ++ AVGND+ G+ L ++ Sbjct: 4 LKIIAVGEYLWDYLPNGKKIGGAAANFCYHAKSAGAQAILVSAVGNDDNGRELLNQLNIL 63 Query: 66 GV-QTIDPVVDYETSTVIITLHN-GIPSYNVKLNVAWDHLKLTDSIIEKAKE-LDAVCFG 122 G+ + YET V++ L G P+YN+ VAWD ++LT+S+ + K+ + A+ FG Sbjct: 64 GIPHDVQTSTHYETGKVMVELDAAGKPTYNIINPVAWDDVQLTESLQKLLKDDIVAIYFG 123 Query: 123 TIAQRSEETRKSIIQFLKLMKPNSFKVFDVNLRQHFYNDDIIQESLSLSNIVKMSDEEIQ 182 ++ QR++ + + + + N + D+NLRQ+ Y +I++ SL ++I+K++DEE+ Sbjct: 124 SLIQRNKNNHQLLKTIVTSLPSNIKIIVDINLRQNHYTYEILRFSLEHTHILKLNDEELP 183 Query: 183 EVGKACGFQGNDLEILKQIHHQYHLKYSLLTLGEKGSYVYDGTNEIFCEPTKVNVVNTVG 242 + + + + +H Y L+ + T G +GSY+ + +C K+ ++TVG Sbjct: 184 VIADLLNIKADPNVLYDYLHKNYQLELLIYTCGSEGSYLISENEQDYCPAEKITPIDTVG 243 Query: 243 AGDSFTAIFVGSILKGKSIEQAQKLASKVASYVCTQDSAMPKLTQELLSEL 293 AGDSF A LKG+ +++ A+ +A+YVCTQ MP + +E++ +L Sbjct: 244 AGDSFMATASILYLKGRKLKEINAKANHIAAYVCTQSGPMPLMPEEMVKDL 294 Lambda K H 0.318 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 233 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 294 Length adjustment: 26 Effective length of query: 268 Effective length of database: 268 Effective search space: 71824 Effective search space used: 71824 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory