Align sorbitol dehydrogenase, D-fructose forming (EC 1.1.1.14) (characterized)
to candidate WP_039104375.1 FPB0191_RS04620 SDR family oxidoreductase
Query= reanno::BFirm:BPHYT_RS16120 (260 letters) >NCBI__GCF_000807275.1:WP_039104375.1 Length = 246 Score = 108 bits (270), Expect = 1e-28 Identities = 76/252 (30%), Positives = 125/252 (49%), Gaps = 17/252 (6%) Query: 8 KVAILTGAASGIGEAVARRYLDEGARCVLVDVKPADSFGDSLRATYGDRVLTVSADVTRR 67 K I+TGA+SGIG A+ + YLD+G V + + +L V+ D++ Sbjct: 5 KTVIVTGASSGIGFAITKAYLDQGYNVVANGRDKGRLDEAAKQLGQPTNLLLVAGDISLP 64 Query: 68 DDIQRIVASTLERFGQIDILFNNAALFDMRPILEESWDVFDRLFAVNVKGMFFLMQAVAQ 127 + + + + FG+IDIL NNA +F +PI + + + D + N+KG F+ Q +A Sbjct: 65 ETAKSLFTLAQKHFGKIDILVNNAGIFISKPISQYTAEDLDNIINTNLKGFFYPTQ-LAV 123 Query: 128 KMVEQGCGGKIINMSSQAGRRGEALVSHY--CATKAAVLSYTQSAALALAPHKINVNGIA 185 + ++ GG I+N+++ + V TK A+ S + AL LA I VNGIA Sbjct: 124 EYMKPNKGGHIVNITAAIALQPNLAVPALLPIMTKGAINSAIKGLALELANDNIRVNGIA 183 Query: 186 PGVVDTPMWNEVDALFARYENRPLGEKKRLVGEAVPLGRMGVPDDLTGAALFLASADADY 245 PG++ TPM + +++ L K L P +G D+ A L+L D+ + Sbjct: 184 PGIIQTPMHTQ--------DHQSLSMLKSL----CPSNNIGQVTDIVDAVLYL--TDSQF 229 Query: 246 ITAQTLNVDGGN 257 +T + VDGG+ Sbjct: 230 VTGTVMVVDGGS 241 Lambda K H 0.321 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 142 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 246 Length adjustment: 24 Effective length of query: 236 Effective length of database: 222 Effective search space: 52392 Effective search space used: 52392 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory