Align D-lactate dehydrogenase (EC 1.1.1.28) (characterized)
to candidate WP_039103118.1 FPB0191_RS00075 phosphoglycerate dehydrogenase
Query= BRENDA::O66939 (334 letters) >NCBI__GCF_000807275.1:WP_039103118.1 Length = 413 Score = 129 bits (325), Expect = 1e-34 Identities = 96/295 (32%), Positives = 149/295 (50%), Gaps = 24/295 (8%) Query: 12 DVPFYQEALKDLSLKIYTTDVSKVPENELKKAELISVFVYDKLTEELLSKMPRLKLIHTR 71 ++ +Y+ AL + LK +K A I V +LTE++++ P+L I Sbjct: 34 NIEYYKGALTEQELK-----------EAIKDARFIGVRSRTQLTEDIINCAPKLAGIGCF 82 Query: 72 SVGFDHIDLDYCKKKGILVTHIPAYSPESVAEHTFAMILTLVKRLKRIEDRVKKLNFSQD 131 +G + ++L KKGI V + P + SVAE A I+ L++R+ + +++ Sbjct: 83 CIGTNQVNLSAASKKGIPVFNAPFSNTRSVAELVLAEIILLLRRVPEANAQAHLGKWNKI 142 Query: 132 SEILARELNRLTLGVIGTGRIGSRVAMYGLAFGMKVLCYDVVKREDLKEKGCVYTSLDEL 191 + I + E +LG+IG G IGS++++ + GMKV YD+ + L + SL L Sbjct: 143 A-IGSHETRGKSLGIIGYGHIGSQLSVLAESLGMKVFFYDIETKLPLGNAKQM-PSLAAL 200 Query: 192 LKESDVISLHVPYTKETHHMINEERISLMKDGVYLINTARGKVVDTDALYRAYQRGKFSG 251 ESDVISLHVP T +MI+++ + +MK L+N +RGKVVD +AL A +G Sbjct: 201 FAESDVISLHVPENATTINMISKKELEMMKPRSILVNASRGKVVDIEALANALADKHIAG 260 Query: 252 LGLDVFEDEEILILKKYTEGKATDKNLKILELACKDNVIITPHIAYYTDKSLERI 306 +DVF E + +T L DNVIITPHI T ++ E I Sbjct: 261 AAIDVFPSEPASNSEPFTS-----------PLCQFDNVIITPHIGGSTIEAQENI 304 Lambda K H 0.319 0.138 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 272 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 334 Length of database: 413 Length adjustment: 30 Effective length of query: 304 Effective length of database: 383 Effective search space: 116432 Effective search space used: 116432 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory