Align Fe(3+) dicitrate transport system permease protein FecC; Iron(III) dicitrate transport system permease protein FecC (characterized)
to candidate WP_041086373.1 KP78_RS03515 iron ABC transporter permease
Query= SwissProt::P15030 (332 letters) >NCBI__GCF_000829435.1:WP_041086373.1 Length = 334 Score = 182 bits (461), Expect = 1e-50 Identities = 111/323 (34%), Positives = 180/323 (55%), Gaps = 7/323 (2%) Query: 10 LWGLPVAALIIIFWLSLFCYSAIPVSGA-DATRALLPGHTPTLPEALVQNLRLPRSLVAV 68 L GL +++ F F + IP S +A P T L ++ RL R+++A+ Sbjct: 12 LVGLLGLVIVLFFGSLAFGQTTIPFSTTWEAITRYDPADTNHL---IIGTSRLTRAVIAL 68 Query: 69 LIGASLALAGTLLQTLTHNPMASPSLLGINSGAALAMALTSA-LSPTPIAGYSLSFIAAC 127 +IG +LA+AG +Q LT NP+A+P LLGINSGA + L L + + Y + A Sbjct: 69 VIGMNLAIAGVFVQALTRNPLAAPDLLGINSGAIFFIVLAITWLEVSSLTQYM--WFAFL 126 Query: 128 GGGVSWLLVMTAGGGFRHTHDRNKLILAGIALSAFCMGLTRITLLLAEDHAYGIFYWLAG 187 G G++ +V G R K+IL+G+ALSA T+ L++ E + +W+AG Sbjct: 127 GAGIAGAVVFFLGSIGRDGLTPIKVILSGVALSALFTSFTQGLLVVDEQSIQTVLFWIAG 186 Query: 188 GVSHARWQDVWQLLPVVVTAVPVVLLLANQLNLLNLSDSTAHTLGVNLTRLRLVINMLVL 247 V+ + + +LP ++ A+ V L + + + + D A LG +++++ +L++ Sbjct: 187 SVAGRDMEMLVSVLPFLLGALIVSLFMGRAIGIFSSGDDVAKGLGQRTGIIKVLMGVLII 246 Query: 248 LLVGACVSVAGPVAFIGLLVPHLARFWAGFDQRNVLPVSMLLGATLMLLADVLARALAFP 307 +L G V+V G V FIGL+VPH+A+ G D R ++P S LLGA L+L AD++AR + FP Sbjct: 247 ILAGGSVAVVGSVGFIGLIVPHMAKGLVGNDYRWMIPYSALLGAALLLAADIVARFIIFP 306 Query: 308 GDLPAGAVLALIGSPCFVWLVRR 330 ++P G + A IG P F++L R+ Sbjct: 307 QEVPIGVMTAFIGGPFFIYLARK 329 Lambda K H 0.327 0.140 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 308 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 334 Length adjustment: 28 Effective length of query: 304 Effective length of database: 306 Effective search space: 93024 Effective search space used: 93024 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory