Align TRAP transporter, subunit DctQ (characterized, see rationale)
to candidate WP_043917823.1 jaqu_RS04900 TRAP transporter small permease
Query= uniprot:I7EY26 (225 letters) >NCBI__GCF_000877395.1:WP_043917823.1 Length = 247 Score = 197 bits (501), Expect = 1e-55 Identities = 104/226 (46%), Positives = 143/226 (63%), Gaps = 12/226 (5%) Query: 7 GPTG-LINTLEETLIALLLGLMTLITFANVVARFVFNSNILWALELTVFLFAWLVLLGAS 65 GP G +NTLEET IALLLGLM L+TF NVV R+ FN++++W LEL + LF+WLV+ G S Sbjct: 10 GPVGRFVNTLEETGIALLLGLMVLVTFVNVVLRYGFNTSLIWGLELVLILFSWLVIFGVS 69 Query: 66 YAVKVHAHLGVDAILNMVSPGARRVIGLISVGCCLVFSLLLLKGAYDYWAVFADLPPTSG 125 Y KV AHLGVDA+ N + RR+ L++ C+ ++LL+LKGA+D+WA F + PT+G Sbjct: 70 YGFKVTAHLGVDALTNALPHRGRRICALVAGVICVAYALLMLKGAWDFWAPFGNFAPTTG 129 Query: 126 RWFPTGF-DMKARS-QSFYEVQDVPMVAIFGFLED-----LINYGD-SYEKLPKVVPYVV 177 RWFP GF +MK Q + VP+ FL L+ GD EK P+ +PY++ Sbjct: 130 RWFPDGFKEMKIHHFQGYIPTDQVPLPE---FLRSPLEAWLLLEGDPPLEKFPRAIPYII 186 Query: 178 LPLSMLLMLLRFAQAAMQILRGDVDRLVASHEVEDEIAEVQAQRGE 223 LPL LL+L R QA +I+RG + L+ SHE E+ + + E Sbjct: 187 LPLGTLLILFRIGQAVYEIVRGTRESLIVSHEAEEAVEDAARAHDE 232 Lambda K H 0.327 0.142 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 157 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 225 Length of database: 247 Length adjustment: 23 Effective length of query: 202 Effective length of database: 224 Effective search space: 45248 Effective search space used: 45248 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory