Align 3-oxoadipate enol-lactonase (EC 3.1.1.24); 4-carboxymuconolactone decarboxylase (EC 4.1.1.44) (characterized)
to candidate WP_043919557.1 jaqu_RS13695 3-oxoadipate enol-lactonase
Query= BRENDA::Q0SH24 (400 letters) >NCBI__GCF_000877395.1:WP_043919557.1 Length = 257 Score = 151 bits (382), Expect = 2e-41 Identities = 89/244 (36%), Positives = 133/244 (54%), Gaps = 6/244 (2%) Query: 18 DAPVVVLLGSLGSNRSMWDPQIAALSYECRVVAVDQRGHGESPAPDGPYSVRDLSEDVLA 77 + P +++ SLG++ +WD I +L RV+ D+RGHG S P PY + L D A Sbjct: 20 NGPPILMANSLGTDVRLWDGIIPSLE-GYRVIRWDKRGHGNSEVPPPPYKMGTLVSDAEA 78 Query: 78 LLDSLGVDAAHFVGLSMGGAIAQWLGAHAPRRVLSLSLLCTAAKFGEPQAWIERAAASRT 137 +LD+L + AA VG S+GG IAQ L P +V ++ L TA K G Q W ER A + Sbjct: 79 VLDALSIKAAVVVGCSIGGMIAQGLAVKRPDQVRAVVLSNTAVKMGTAQMWQERIDAVQA 138 Query: 138 DGPESLADAVVARWFSEGLAKRDPEFVRHYREMIASTSPEGYAACCDALADWDFTADLSR 197 G E++ DAV+ RWF A R P+ +R+ + T EGYA CC ALA D S Sbjct: 139 GGMEAVVDAVLDRWF----APRFPDRAL-WRQRLLETPAEGYAGCCAALAGADLLTPTSG 193 Query: 198 ISAPTLVIAGEEDPSTPPSVMQILADGITEARFEVLSPAAHVANLEQAGAVTALLREHIV 257 + P L +AG+ D ++PP +++ LAD I +RF ++ + H+ ++ A L + + Sbjct: 194 LRLPALCVAGDRDGASPPDMVRELADLIPGSRFHLIRGSGHLPMVDAPDAFANALTDFLT 253 Query: 258 GAGY 261 G+ Sbjct: 254 AIGH 257 Lambda K H 0.318 0.132 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 291 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 257 Length adjustment: 28 Effective length of query: 372 Effective length of database: 229 Effective search space: 85188 Effective search space used: 85188 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory