Align L-proline and D-alanine ABC transporter, permease component 1 (characterized)
to candidate WP_043918392.1 jaqu_RS07820 branched-chain amino acid ABC transporter permease
Query= reanno::azobra:AZOBR_RS08235 (301 letters) >NCBI__GCF_000877395.1:WP_043918392.1 Length = 302 Score = 152 bits (383), Expect = 1e-41 Identities = 102/309 (33%), Positives = 161/309 (52%), Gaps = 30/309 (9%) Query: 5 LQQLINGLSLGAIYGLIAIGYTMVYGIIGMINFAHGEIYMIGAFVALITFLAIGSLGITW 64 ++QL+NGL LG + L+A G T+V+G++G+IN AHG +YM+GAF A GS Sbjct: 6 IEQLLNGLQLGVMLFLMAAGLTLVFGVMGLINLAHGSLYMVGAFAAAWVAAQTGS----- 60 Query: 65 VPLALLVMLVASMLFTAVYGWTVERIAYRPLRSSPRLAPLISAIGMSIFLQNYVQILQGA 124 L+ LVAS+ A G +E + R L + L +++ + + + + G Sbjct: 61 ----YLLALVASLAAAAAAGVLIETLILRRLYARDHLDQVLATFALILIFSEGTRAVFG- 115 Query: 125 RSKPL----QPILPGNLTLMDGAVSVSYVRLATIVITIALMYGFTQLITRTSLGRAQRAC 180 S PL P L G +TL G + RL I +A+ G LITRT +G +A Sbjct: 116 -SFPLYLTIPPPLSGPVTL-PGGIEYPLFRLVLIGAGLAVALGLWLLITRTRVGIRIQAG 173 Query: 181 EQDKKMAGLLGVNVDRVISLTFVMGAALAAVAGMMVLLIYGVIDFYIGFLAGVKAFTAAV 240 D++M LGV++ R+ +L F +GAALA ++G +V + V + +G + AF V Sbjct: 174 AADREMVSALGVDISRLYTLVFALGAALAGLSGALVGTLQSV-EVGMGEPVLITAFVVIV 232 Query: 241 LGGIGSLPGAMLGGVVIGLIEAFWSGYM-------------GSEWKDVATFTILVLVLIF 287 +GGIGS+ GA++G +++GL + + + G + + ++ LVLI Sbjct: 233 IGGIGSVQGALVGAILVGLTQTLGAFLLPLASTRLTGAPDAGQVLASMLIYILMALVLIV 292 Query: 288 RPTGLLGRP 296 RP GL+GRP Sbjct: 293 RPQGLMGRP 301 Lambda K H 0.329 0.144 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 306 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 302 Length adjustment: 27 Effective length of query: 274 Effective length of database: 275 Effective search space: 75350 Effective search space used: 75350 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory