Align High-affinity branched-chain amino acid transport system permease protein BraD, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate WP_043918392.1 jaqu_RS07820 branched-chain amino acid ABC transporter permease
Query= TCDB::P21627 (307 letters) >NCBI__GCF_000877395.1:WP_043918392.1 Length = 302 Score = 139 bits (350), Expect = 8e-38 Identities = 95/310 (30%), Positives = 154/310 (49%), Gaps = 29/310 (9%) Query: 8 LQQLVNGLTVGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYIAFIAITLLAMMGLDS 67 ++QL+NGL +G L+A G T+V+G++G+IN AHG +YM+G AF A + A G Sbjct: 6 IEQLLNGLQLGVMLFLMAAGLTLVFGVMGLINLAHGSLYMVG---AFAAAWVAAQTG--- 59 Query: 68 VPLMMLAAFAASIIVTSAFGYSIERVAYRPLRGGNRLIPLISAIGMSIFLQNA--VMLSQ 125 L A AS+ +A G IE + R L + L +++ + + + Sbjct: 60 ---SYLLALVASLAAAAAAGVLIETLILRRLYARDHLDQVLATFALILIFSEGTRAVFGS 116 Query: 126 DSKEKAIPTLLPGNFVFGESSMNGVVISYMQILIFVVTFLVMFGLTLFISRSRLGRACRA 185 IP L G G+ ++++ V GL L I+R+R+G +A Sbjct: 117 FPLYLTIPPPLSGPVTL----PGGIEYPLFRLVLIGAGLAVALGLWLLITRTRVGIRIQA 172 Query: 186 CAEDLKMTNLLGINSNNIIALTFVIGAALAAVAAVLLGMQYGVINPGIGFLAGIKAFTAA 245 A D +M + LG++ + + L F +GAALA ++ L+G V G+G I AF Sbjct: 173 GAADREMVSALGVDISRLYTLVFALGAALAGLSGALVGTLQSV-EVGMGEPVLITAFVVI 231 Query: 246 VLGGIGSIPGAMLGGLLLGVAEAFGADVF-------------GDQYKDVVAFGLLILVLL 292 V+GGIGS+ GA++G +L+G+ + GA + G ++ + L+ LVL+ Sbjct: 232 VIGGIGSVQGALVGAILVGLTQTLGAFLLPLASTRLTGAPDAGQVLASMLIYILMALVLI 291 Query: 293 FRPTGILGRP 302 RP G++GRP Sbjct: 292 VRPQGLMGRP 301 Lambda K H 0.328 0.145 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 256 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 302 Length adjustment: 27 Effective length of query: 280 Effective length of database: 275 Effective search space: 77000 Effective search space used: 77000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory