Align Glyoxylate reductase; EC 1.1.1.26 (uncharacterized)
to candidate WP_043920587.1 jaqu_RS19020 D-glycerate dehydrogenase
Query= curated2:B1L765 (332 letters) >NCBI__GCF_000877395.1:WP_043920587.1 Length = 313 Score = 237 bits (604), Expect = 3e-67 Identities = 133/318 (41%), Positives = 188/318 (59%), Gaps = 8/318 (2%) Query: 4 RVFVTREIPERGLSKIEEHFELDLWKDEAPPSKKVIIERVKDCDALVSLLTDPIDAEVFE 63 ++FV+R +P+ + EHFE+ + P + + D ++ L D A+ F Sbjct: 2 KLFVSRALPDSVMEAAAEHFEVTCRETTQPMDLDECRAALAEADVILPTLGDAFGADAFP 61 Query: 64 AAPKLRIVAQYAVGYDNIDVKEATKRGIYVTNTPGVLTETTADFAFALLMAAARRVVEAD 123 + R +A + VGY++IDV A G+ VTNTPG +T+ TAD A L++ ARR E + Sbjct: 62 GEIRARGLANFGVGYNHIDVGAARAAGLVVTNTPGAVTDATADIALTLILMTARRAGEGE 121 Query: 124 RYVREGKWKVAWHPMMMLGYDVYGRTLGIVGMGRIGAAVARRAK-GFGMRILYYD-SIRR 181 R VR G+W WHP MLG V G+T+GIVGMGRIG A+A R + GFGM +++Y+ S +R Sbjct: 122 RVVRSGRWG-GWHPTQMLGLHVTGKTVGIVGMGRIGQAIAHRCRAGFGMEVVFYNRSDKR 180 Query: 182 EDFEKELGVEYVPLEKLLEESDFVSLHVPLTEETYHMIGEEQLRRMKRTAILVNTSRGKV 241 D ++LG + ++ +D V + V T ET H+I + L M+ AILVN +RG V Sbjct: 181 IDGARQLG----SVSEVCAAADVVVMAVAATPETRHLIDADALSAMRPHAILVNIARGDV 236 Query: 242 VDQKALYKALKEGWIAGAGLDVFEQEPIPPDDPLLKLENVVLAPHAASASHETRSRMAEM 301 +D+ AL AL++ IAGAGLDV+E EP+ P D L+ LEN VL PH +A+ E R M M Sbjct: 237 IDEGALIDALRDRRIAGAGLDVYENEPVVP-DTLMTLENAVLLPHLGTAALEVREAMGRM 295 Query: 302 VAENLIAFKRGEIPPNLV 319 +N IA G PPN V Sbjct: 296 ALDNAIAIAEGRTPPNPV 313 Lambda K H 0.319 0.137 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 228 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 313 Length adjustment: 28 Effective length of query: 304 Effective length of database: 285 Effective search space: 86640 Effective search space used: 86640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory