Align Histidine transport system permease protein HisQ (characterized)
to candidate WP_043917275.1 jaqu_RS02045 ABC transporter permease subunit
Query= SwissProt::P0A2I9 (228 letters) >NCBI__GCF_000877395.1:WP_043917275.1 Length = 237 Score = 176 bits (445), Expect = 5e-49 Identities = 93/219 (42%), Positives = 137/219 (62%) Query: 4 GFSGVILQGAIVTLELALSSVVLAVLIGLVGAGAKLSQNRVTGLIFEGYTTLIRGVPDLV 63 G+ G +L+G + TL++AL + L + IG++GA K+ + E YTTLIR VP+LV Sbjct: 14 GWGGNLLRGLVSTLQIALGAYALGMSIGILGALGKIHGGPILRGALEVYTTLIRAVPELV 73 Query: 64 LMLLIFYGLQIALNVVTDSLGIDQIDIDPMVAGIITLGFIYGAYFTETFRGAFMAVPKGH 123 L+LL+FY Q A+NV+ SLG +++ +D + GI +GF+ GAY TE FRGAF AV G Sbjct: 74 LILLLFYAGQDAINVILTSLGFERVILDGLWVGIYVIGFVQGAYSTEVFRGAFGAVAPGQ 133 Query: 124 IEAATAFGFTHGQTFRRIMFPAMMRYALPGIGNNWQVILKATALVSLLGLEDVVKATQLA 183 IEAA A G + + R++ P M+ +ALPG+ N W + K TAL++++G+ ++ T+ A Sbjct: 134 IEAARAIGMSRLKVQTRVVIPLMLPFALPGLANLWLITTKDTALLAVVGVSELALETRQA 193 Query: 184 GKSTWEPFYFAVVCGLIYLVFTTVSNGVLLLLERRYSVG 222 +T F F V G +YL+ T VSN + LERR G Sbjct: 194 AGATRAYFLFYVAAGCLYLLVTLVSNQIFAWLERRLRRG 232 Lambda K H 0.328 0.144 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 228 Length of database: 237 Length adjustment: 23 Effective length of query: 205 Effective length of database: 214 Effective search space: 43870 Effective search space used: 43870 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory