Align ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized)
to candidate WP_043919312.1 jaqu_RS12415 ABC transporter ATP-binding protein
Query= reanno::Smeli:SMc04256 (361 letters) >NCBI__GCF_000877395.1:WP_043919312.1 Length = 335 Score = 295 bits (755), Expect = 1e-84 Identities = 167/346 (48%), Positives = 221/346 (63%), Gaps = 30/346 (8%) Query: 1 MTSVSVRDLSLNFGAVTVLDRLNLDIDHGEFLVLLGSSGCGKSTLLNCIAGLLDVSDGQI 60 M + + ++ +FG V V+ L+L I++GEF V +G SGCGKSTLL IAGL DVS G I Sbjct: 1 MGHIKLNQITKSFGDVEVIPPLDLTIENGEFAVFVGPSGCGKSTLLRLIAGLEDVSSGHI 60 Query: 61 FIKDRNVTWEEPKDRGIGMVFQSYALYPQMTVEKNLSFGLKVAKIPPAEIEKRVKRASEI 120 I R+VT P RG+ MVFQSYALYP M+V KN++F L +A + AE ++RV+RA+ + Sbjct: 61 EIDGRDVTDVPPAKRGLAMVFQSYALYPHMSVRKNIAFPLHMAGMDQAEQQRRVERAASV 120 Query: 121 LQIQPLLKRKPSELSGGQRQRVAIGRALVRDVDVFLFDEPLSNLDAKLRSELRVEIKRLH 180 L + L R+P +LSGGQRQRVAIGRA+VR+ FLFDEPLSNLDA LR +R+EI LH Sbjct: 121 LNLTDYLDRRPGQLSGGQRQRVAIGRAIVREPAAFLFDEPLSNLDAALRHGMRMEIGELH 180 Query: 181 QSLKNTMIYVTHDQIEALTLADRIAVMKSGVIQQLADPMTIYNAPENLFVAGFIGSPSMN 240 QSL TMIYVTHDQ+EA+T+AD+I V+++GVI+Q+ P+ +Y P NLFVAGFIGSP+MN Sbjct: 181 QSLSTTMIYVTHDQVEAMTMADKIVVLRAGVIEQVGSPLDLYREPRNLFVAGFIGSPTMN 240 Query: 241 FFRGEVEPKDGRSFVRAGGIAFDVTAYPAHTRLQPGQKVVLGLRPEHVKVDEARDGEPTH 300 G+ K G AHT +G+RPEH+ V DG P Sbjct: 241 LIEGDEARKHG-----------------AHT---------IGIRPEHI-VPGDPDGAP-W 272 Query: 301 QAVVDIEEPMGADNLLWLTFAG--QSMSVRIAGQRRYPPGSTVRLS 344 V + E +G+D L + G +S++VR G+ G V L+ Sbjct: 273 SGTVGLSEHLGSDTFLHVHGTGLTESITVRADGEVPLRHGDRVGLT 318 Lambda K H 0.320 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 376 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 335 Length adjustment: 29 Effective length of query: 332 Effective length of database: 306 Effective search space: 101592 Effective search space used: 101592 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory