Align CBP protein aka CebG, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized)
to candidate WP_043920039.1 jaqu_RS16210 sugar ABC transporter permease
Query= TCDB::Q9X9R5 (276 letters) >NCBI__GCF_000877395.1:WP_043920039.1 Length = 362 Score = 55.8 bits (133), Expect = 1e-12 Identities = 65/212 (30%), Positives = 83/212 (39%), Gaps = 29/212 (13%) Query: 17 LTVFALVSLAPLVWTAIAASRTNHRLAETPPPLWFGGNLFKNLEAAWEQAGLGTAMLNSV 76 L V A+V + IA S N +P F G F N AAW A+LN V Sbjct: 89 LFVVAMVIFPLIFGAGIAMSDWN---LSSPDGRQFNG--FDNFWAAWRDPFYLNALLNMV 143 Query: 77 IVAGTITVSTVLFSTLAGFAFAKLR----FRFSGLLLLLT--------IGTMMIPPQLAV 124 I V V+ LA A++R FR + LL L+ IG M P+ Sbjct: 144 WYTLAILVEYVIAFGLALLLNAQIRARKFFRVAFLLPLMLSPVAVSWMIGKSMFEPRFG- 202 Query: 125 VPLYLWMSDLGWSNQ--------LHTVILPSLVTAFGTFFMRQYL--VQALPTELIEAAR 174 P+ LGW +I+ + F M L +QA+P EL EAA Sbjct: 203 -PMARLARTLGWDTPSFFGSPEIARFMIMAMDAWTYIPFMMIMLLAGLQAIPKELNEAAS 261 Query: 175 VDGASSLRIVWHVVFPAARPAMAVLGLLTFVF 206 VDGAS R W V FP P L+ +F Sbjct: 262 VDGASGWRKFWEVTFPLMLPVSITAILIRIIF 293 Lambda K H 0.327 0.140 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 320 Number of extensions: 21 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 362 Length adjustment: 27 Effective length of query: 249 Effective length of database: 335 Effective search space: 83415 Effective search space used: 83415 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory