Align 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43) (characterized)
to candidate WP_043919922.1 jaqu_RS15540 D-glycerate dehydrogenase
Query= reanno::BFirm:BPHYT_RS11290 (321 letters) >NCBI__GCF_000877395.1:WP_043919922.1 Length = 326 Score = 184 bits (468), Expect = 2e-51 Identities = 119/309 (38%), Positives = 172/309 (55%), Gaps = 7/309 (2%) Query: 4 IVAWKSLPEDVLAYLQQHAQVVQV--DATQHDAFVAALKDADGGIGS-SVKITPAMLEGA 60 +V + LP + A + + V + DA D +A L+DAD + + S + ML + Sbjct: 8 VVVTRRLPPAIEARMDELFAVTRPEGDAFTRDEVLARLRDADVLVPTLSDPVDAPMLAAS 67 Query: 61 TRLKALSTISVGFDQFDVADLTRRGIVLANTPDVLTESTADTVFSLILASARRVVELAEW 120 RL+ ++ G D DVA +RG++++NTP V TE TAD +LILA RR+ E Sbjct: 68 DRLRLVANYGAGVDHIDVATARQRGVLVSNTPGVQTEDTADMTMALILAVIRRMPEGMAK 127 Query: 121 VKAGHWQHSIGPALFGVDVQGKTLGIVGLGRIGGAVARRAALGFNMKVLYTN-RSANPQA 179 ++ G W+ A+ G ++G+ LGI+G+GRIG AVARRA+ F M+V Y N R + Sbjct: 128 MQQGDWEGWAPEAMLGGRLRGRKLGILGMGRIGQAVARRAS-AFGMEVSYHNRRRLHSGI 186 Query: 180 EEAYGARRVE-LAELLATADFVCLQVPLTPETKHLIGAAELKSMKKSAILINASRGATVD 238 E+ GA +E L ++A +D + + P TP T HL+ A L+ MK +A+++N SRG +D Sbjct: 187 EDPLGATYLESLDRMVAQSDVLSVNCPHTPATFHLMNARRLRLMKPTAVIVNTSRGEVID 246 Query: 239 EKALIEALQNGTIHGAGLDVFETEPLPSDSPLLKLANVVALPHIGSATHETRHAMARNAA 298 E AL L+ G + GAGLDV+E + L L NVV PHI SAT E RH M Sbjct: 247 ENALTRMLRGGDLAGAGLDVYE-RGRGVNPRLRALPNVVLTPHIASATREARHEMGERVI 305 Query: 299 ENLVAALDG 307 N+ DG Sbjct: 306 VNMQTFADG 314 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 231 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 326 Length adjustment: 28 Effective length of query: 293 Effective length of database: 298 Effective search space: 87314 Effective search space used: 87314 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory