Align C4-dicarboxylate TRAP transporter large permease protein DctM (characterized)
to candidate WP_043917613.1 jaqu_RS03895 TRAP transporter large permease
Query= SwissProt::Q9HU16 (427 letters) >NCBI__GCF_000877395.1:WP_043917613.1 Length = 438 Score = 274 bits (701), Expect = 3e-78 Identities = 154/418 (36%), Positives = 255/418 (61%), Gaps = 9/418 (2%) Query: 12 LLMFIGVPIAVSLGLSGALTILLFSPDSVRSLAIK---LFETSEHYTLLAIPFFLLSGAF 68 +++F GV +A+ L + +L+F D RSL + +F +++ LL+IP F++ GA Sbjct: 16 VVLFSGVSVALGLLIVSGGFLLIF--DGARSLELMPEIMFGKLDNFALLSIPMFIIMGAS 73 Query: 69 MTTGGVARRLIDFANACVGHIRGGLAIAAVLACMLFAALSGSSPATVAAVGSIAIAGMVR 128 + + L + + + GGL ++ + AC LF+A+SGSSPAT AA+G + I M + Sbjct: 74 IASTRAGADLYEALERWLTRVPGGLVVSNLGACALFSAMSGSSPATCAAIGKMGIPEMRK 133 Query: 129 SGYPQAFGAGIVCNAGTLGILIPPSIVMVVYAAATETSVGKLFIAGVVPGLLL-GLILMV 187 GYP AG + GTLGILIPPS+ M+VY ATETS+G+LF+AGV PGL+L GL + Sbjct: 134 RGYPDEVAAGSIAAGGTLGILIPPSVTMIVYGIATETSIGRLFLAGVFPGLMLVGLFMAW 193 Query: 188 VIYIVARVKKLPAM-PR-VSLREWLASARKALWGLLLMVIILGGIYSGAFTPTEAAAVAA 245 ++ R + PR ++ + L + L +L+++ +L +Y G TP+E AAV A Sbjct: 194 SLFSTWRSGNAQVLAPRSYTMAQRLEVLPRVLPFILIILGVLYAMYGGIATPSETAAVGA 253 Query: 246 VYSAFVALFVYRDMRLSECPKVLLESGKLTIMLMFIIANAMLFAHVLTTEQIPQSIASWV 305 + +A+ +YR + +VL +S + ++M++FII A +F+++L++ I QSIA W+ Sbjct: 254 LLCILIAMVIYRLWSPMKLWEVLRDSTRESVMILFIIGAAGVFSYMLSSLFITQSIAEWI 313 Query: 306 TELGLSPWMFLLVVNIVLLIAGNFMEPSAIILILAPIFFPIAMELGIDPIHLGIIMVVNM 365 L ++ W+ + VN+ LL+AG F+ P A+IL+ API PI G DPI +++ +NM Sbjct: 314 GTLDVNRWVLMGAVNLFLLVAGFFLPPVAVILMAAPILLPIITTAGFDPIWFAVVLTINM 373 Query: 366 EIGLITPPVGLNLFVTSAVT-GMPLGATIRAALPWLMILLVFLIIVTYIPAVSLALPN 422 EIGLI+PPVGLNL+V + + + L + +LP++ +++ ++I+ P ++ LP+ Sbjct: 374 EIGLISPPVGLNLYVINGIAPDIKLKTILTGSLPFVGCMVIAIVILCLFPGIATWLPD 431 Lambda K H 0.330 0.144 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 545 Number of extensions: 27 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 427 Length of database: 438 Length adjustment: 32 Effective length of query: 395 Effective length of database: 406 Effective search space: 160370 Effective search space used: 160370 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory