Align Large component of TRAP-type D-gluconate transporter (characterized)
to candidate WP_043918200.1 jaqu_RS06770 TRAP transporter large permease
Query= reanno::azobra:AZOBR_RS15920 (426 letters) >NCBI__GCF_000877395.1:WP_043918200.1 Length = 426 Score = 266 bits (679), Expect = 1e-75 Identities = 151/417 (36%), Positives = 243/417 (58%), Gaps = 3/417 (0%) Query: 1 MALAVFLSSLFGLMLLGMPIAFALMLTGVALMVHLDFFDAQL-VAQNMLSGADNYPLMAV 59 + LA+F+ + L+ L +PIA AL ++ + +V L+ + + VA +M GA + L+A+ Sbjct: 2 LMLAIFVL-MVALICLNVPIAVALAVSAILGLVVLEGTGSLVNVALDMYGGATKFSLIAI 60 Query: 60 PFFILAGELMNAGGISQRIINLAVSLVGHIRGGLGYVTIGASVMLASLSGSAIADTAALA 119 P F+LAG +MNAGGI+ R+IN +L+G IRGGL +V IG S+ A +SGSA+AD AA+ Sbjct: 61 PMFVLAGAIMNAGGITDRLINFVAALIGFIRGGLAHVNIGVSLFFAEISGSAVADVAAMG 120 Query: 120 TLLIPMMRDNGYPVPRSAGLIASGGIIAPIIPPSMPFIIFGVTTNTSISGLFMAGIVPGL 179 +++IP M+ GY SA + +S +A IIPPS+P I++ + N S+ LF+AG++PGL Sbjct: 121 SVMIPQMKKRGYSGAFSAAVTSSSASLAIIIPPSIPMILYATSANVSVEQLFVAGVIPGL 180 Query: 180 LMGAGLVITWMFVVRGMTVKLQPKASWGERRTALVEGVWALALPVIIIGGLRGGIFTPTE 239 L AGL+ + R + + S A V+ + ALPVII+GG+ GG T TE Sbjct: 181 LGAAGLMGVSYYFARRYDLPREDAFSGRVLWRAFVDALPTFALPVIILGGIFGGYVTATE 240 Query: 240 AAVVAAVYSLVVALFVYRQVTLKDLVPLLVQAARTTSTVMFLCAAALVSSYMVTLADLPQ 299 AA +A + ++ ++L+ YRQV K L ++ T+ VM L AA++V +T A PQ Sbjct: 241 AAGLAVLAAIAISLY-YRQVDFKHLQRSMLDGGMQTAVVMLLVAASVVMGGFLTRAQYPQ 299 Query: 300 QMNEMLAPLLHEPKLLMVAITLLLLAVGTVMDLTPTILVLGPVLTPLAAAAGIDPTYFGV 359 ++ + + L+++ + L +G + I+++ P++ PL AAGI+P +FG+ Sbjct: 300 ELAAAILGITENKWLILLILNFFFLVIGFFLHSAAAIILVVPIVIPLIDAAGINPIHFGL 359 Query: 360 MFVLTGTLGLIHPPVCTVLNVVCGVARISLESATRGIWPFLLTYLLLLCLLIAVPEI 416 + L +G PPV +VL C VAR ++ T+ F+ L +L + +P I Sbjct: 360 VVTLNLAIGQQTPPVASVLITACAVARANIWDVTKVNVYFIAVLLAVLLMCTYIPAI 416 Lambda K H 0.328 0.142 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 465 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 426 Length of database: 426 Length adjustment: 32 Effective length of query: 394 Effective length of database: 394 Effective search space: 155236 Effective search space used: 155236 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory