Align Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_043918810.1 jaqu_RS09840 branched-chain amino acid ABC transporter permease
Query= uniprot:Q1MCU0 (300 letters) >NCBI__GCF_000877395.1:WP_043918810.1 Length = 336 Score = 136 bits (342), Expect = 8e-37 Identities = 99/307 (32%), Positives = 153/307 (49%), Gaps = 31/307 (10%) Query: 4 FVQQLLNGLTLGSIYGLVAIGYTMVYGIIGMINFAHGDIFMLGGFAALIVFLVLTSIFAG 63 F+ + G+TLG++Y LVA G+T+++G++ +N AHG +++LGG+ V S Sbjct: 44 FLNAVFGGVTLGALYFLVASGFTLIFGLMRNVNLAHGSLYLLGGYIGFEVSERTGSWLLA 103 Query: 64 LPVAVLLLVMLVVAMLMTSLWNWTIERVAYRPLRGSFRLAPLITAIGMSITLSNFIQVTQ 123 PV V +VVA L L N R+ LR + + IG+S+ +++ + Sbjct: 104 FPV-----VFIVVAALGLILQNQVFRRMEGEELRQT------MVTIGLSVVIADILLWIW 152 Query: 124 GPRNKPI-----------PPMVSSVYQFGNISVSLK----QIIIIVITAVLLTIFWYIVN 168 G ++ I P+VS G I V L+ ++ I+ V+ W+++N Sbjct: 153 GGQSYTIFAPDWLSGPMTLPIVSGTRSSGEI-VFLRYPAVRMAILFAAIVVGFAMWFVLN 211 Query: 169 RTALGRAQRATEQDRKMAALLGVNVDQTISITFVMGAALAAVAGTMYLMYYGVASFND-G 227 RT LG RA DR+M A GV + F GA LA +AG + + ++ D Sbjct: 212 RTKLGMLVRAGVDDREMLAASGVRIQYVFLAVFGFGAGLAGMAGIIGGTFQSLSPGEDTR 271 Query: 228 FTPGVKAFTAAVLGGIGSLPGAVFGGLLIGLIESLWSAYFTIAYKDVATFAILAFVLIFK 287 F + + ++GG+GS+PGA G L+IGL E L Y Y V TF I+A VL F+ Sbjct: 272 FL--LASLVVVIVGGMGSIPGAAIGALVIGLAEQLGLVY-APTYSVVFTFLIMAAVLAFR 328 Query: 288 PTGILGR 294 P G+LGR Sbjct: 329 PQGLLGR 335 Lambda K H 0.329 0.143 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 370 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 336 Length adjustment: 27 Effective length of query: 273 Effective length of database: 309 Effective search space: 84357 Effective search space used: 84357 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory