Align Probable enoyl-CoA hydratase; EC 4.2.1.17 (uncharacterized)
to candidate WP_043917847.1 jaqu_RS05030 enoyl-CoA hydratase/isomerase family protein
Query= curated2:P24162 (257 letters) >NCBI__GCF_000877395.1:WP_043917847.1 Length = 258 Score = 318 bits (814), Expect = 9e-92 Identities = 161/258 (62%), Positives = 194/258 (75%), Gaps = 1/258 (0%) Query: 1 MSYHTIRYEISEGLAVITLDRPEVMNALNAAMRHELTAALHRARGEARAIVLTGSGRAFC 60 M Y TIR +G+ +TL RP+VMNAL+ MR E+ A+ A AR +V+TG G+AFC Sbjct: 1 MDYETIRVRDRDGVTTLTLARPKVMNALSTQMRAEILHAVREAEQTARVLVMTGEGKAFC 60 Query: 61 SGQDLGDGA-AEGLNLETVLREEYEPLLQAIYSCPLPVLAAVNGAAAGAGANLALAADVV 119 SGQDLGD A A LNLE VLR+EYEP+L+AI+ C +P +AAVNG AAGAGANLALA DVV Sbjct: 61 SGQDLGDRANAADLNLERVLRDEYEPMLKAIFDCQIPTIAAVNGPAAGAGANLALACDVV 120 Query: 120 IAAQSAAFMQAFTRIGLMPDAGGTWWLPRQVGMARAMGMALFAEKIGAEEAARMGLIWEA 179 IA +SA F+QAFTRIGL+PDAGGT+WLPRQ+GMA+AMG ALFAE I A +A+ G+IWEA Sbjct: 121 IATESAVFLQAFTRIGLIPDAGGTYWLPRQMGMAKAMGAALFAEPITARQASDWGMIWEA 180 Query: 180 VPDVDFEHHWRARAAHLARGPSAAFAAVKKAFHAGLSNPLPAQLALEARLQGELGQSADF 239 VPD DF HW RA HLA GP+ A+AAVK+A + QLA+EA+LQG G+S DF Sbjct: 181 VPDEDFVAHWAERARHLATGPTGAYAAVKEAIRGSYDHTRDEQLAVEAKLQGRCGKSRDF 240 Query: 240 REGVQAFLEKRPPHFTGR 257 +EGV AFLEKRP F GR Sbjct: 241 QEGVLAFLEKRPAKFEGR 258 Lambda K H 0.321 0.133 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 181 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 258 Length adjustment: 24 Effective length of query: 233 Effective length of database: 234 Effective search space: 54522 Effective search space used: 54522 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory