Align L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate WP_043917268.1 jaqu_RS02010 SDR family oxidoreductase
Query= reanno::pseudo6_N2E2:Pf6N2E2_5967 (272 letters) >NCBI__GCF_000877395.1:WP_043917268.1 Length = 246 Score = 147 bits (372), Expect = 2e-40 Identities = 90/252 (35%), Positives = 135/252 (53%), Gaps = 8/252 (3%) Query: 18 RLKNKVVLLTGAAQGIGEAIVAAFASQQARLVISDIQAEKVETVAAHWRERGADVHALKA 77 RLK+K ++TG A G G IV FA++ AR++I+D+ + E +A + HA +A Sbjct: 2 RLKDKTAIVTGGASGFGAGIVRKFAAEGARVLIADLNGDDAEALAEELEQ-----HATEA 56 Query: 78 DVSNQQDLHAMARHAVERHGRIDVLVNCAGVNVFRDPLE-MTEEDWRRCFAIDLDGAWYG 136 DVS+ + AM R A G +D+LVN AG+ P+E ++E D+ R FA++ + Sbjct: 57 DVSDGASVGAMVREAQRLFGEVDILVNNAGITHLPAPMEEVSESDFDRVFAVNCKSVYLT 116 Query: 137 CKAVLPQMIEQGVGSIINIASTHSSHIIPGCFPYPVAKHGLLGLTRALGIEYAPKGVRVN 196 + +P M +G G+I+N+AST P Y +K ++ TRA+ +E AP+GVRVN Sbjct: 117 ARHAVPLMKARGAGAILNVASTAGVSPRPRLNWYNASKGWMITATRAMAVELAPEGVRVN 176 Query: 197 AIAPGYIETQLNVDYWNGFADPYAERQRALDLHPPRRIGQPIEVAMTAVFLASDEAPFIN 256 A+ P ET L + D R + L P R P ++ A FL SDEA I Sbjct: 177 ALNPVAGETPLLKSFMG--EDTPEIRAKFLSTIPLGRFSTPEDMGNAACFLCSDEASMIT 234 Query: 257 ASCITIDGGRSV 268 C+ +DGGR + Sbjct: 235 GVCMQVDGGRCI 246 Lambda K H 0.321 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 155 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 246 Length adjustment: 24 Effective length of query: 248 Effective length of database: 222 Effective search space: 55056 Effective search space used: 55056 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory