Align Probable galactose dehydrogenase GalD; EC 1.1.1.- (characterized)
to candidate WP_043918249.1 jaqu_RS07060 3-hydroxybutyrate dehydrogenase
Query= SwissProt::Q92RN6 (256 letters) >NCBI__GCF_000877395.1:WP_043918249.1 Length = 261 Score = 125 bits (314), Expect = 9e-34 Identities = 82/262 (31%), Positives = 129/262 (49%), Gaps = 19/262 (7%) Query: 6 SQFPDLRDRGVLVTGGGSGIGAALVEAFARQGARV---AFVDIAAESSLALCEKVAAQTG 62 S + L+ + +VTG SGIG + +FA G V +F D + AL +++AA+T Sbjct: 2 SDYAALKGKTAIVTGSNSGIGLGIARSFAAAGLDVVLNSFTD--RDEDHALAKEIAAETR 59 Query: 63 QAPHFIQADLRNVEAVRAAADEAVAKLGSVRVLVNNAARDDRQALEAVTEESWDESLSVN 122 +I+ADL N + RA ++A G+ VLVNNA ++ WD +++N Sbjct: 60 TKTRYIKADLSNGDEARALVEQA----GACDVLVNNAGIQHVAGIDEFPAAKWDAIIAIN 115 Query: 123 LRHLFFMCQAVAPHMQRQGGGSIVNFSSIAFLLNMPEIPAYSTAKAGIIGLTKSLAGKLG 182 L F A P M++ G G ++N +S L P AY AK G++G+TK +A + Sbjct: 116 LSSAFHTTAAALPMMRKAGWGRVINIASAHGLTASPFKSAYVAAKHGVVGMTKVVALETA 175 Query: 183 PDNIRVNAILPGMIVT--------ERQRRLWLTEESIAR--MQERQCLKRMLVADDLVGP 232 + I NAI PG ++T + + + E+ R + +RQ K D L G Sbjct: 176 EEPITANAICPGYVMTPLVESQIPDTMEKYGMDRETAIREVLLQRQPSKEFATTDQLGGT 235 Query: 233 CLFLASDSSAAMTAQAMIIDGG 254 LFL +D +A +T + +DGG Sbjct: 236 ALFLCTDHAAQITGTTISVDGG 257 Lambda K H 0.321 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 97 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 261 Length adjustment: 24 Effective length of query: 232 Effective length of database: 237 Effective search space: 54984 Effective search space used: 54984 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory